DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:435 Identity:97/435 - (22%)
Similarity:152/435 - (34%) Gaps:122/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RILAIFPFPGPSQYINVVPYLKELANRGHQV----TSVNAFPQKKPVVNFRDVFIPDVF--NNYK 79
            |.:.:.|.|.......::...:.|..:|..:    |..|.....|.:.:|:.:.||:..  ::.|
plant     9 RRIVLIPAPAQGHISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFITIPESLPASDLK 73

  Fly    80 ELINELSGPMNLWQENNFINKFFVSVTR-CVLTNKE------VTETLLPPGKDHFDLIIVEALRS 137
            .|     ||  :|        |.:.:.: |..:.||      :.:.|:|  ::....:|.:..  
plant    74 NL-----GP--VW--------FLLKLNKECEFSFKECLGQLLLQKQLIP--EEEIACVIYDEF-- 119

  Fly   138 DAYYGFAA--HFNAPIIGIST---------------FGTD---------WNIDALVGNESPLSYT 176
             .|:..||  .||.|.:..||               :..|         ...:.||....||.|.
plant   120 -MYFAEAAAKEFNLPKVIFSTENATAFACRSAMCKLYAKDGLAPLKEGCGREEELVPKLHPLRYK 183

  Fly   177 PLATGGLTDRMTFLERLSNFVD--TTVAWL--NYRFVHMSEQEKMYAKYFPEASKRVQLTDLNRN 237
            .|.|.........:|...:..|  |..|.:  ..|.:.:|                         
plant   184 DLPTSAFAPVEASVEVFKSSCDKGTASAMIINTVRCLEIS------------------------- 223

  Fly   238 FSLVLLNQHFSLSFPRPYVPNMIEVGGLHI--SHKPAPLPKDLE---EFIQGSGEHGVIYFSLGS 297
             ||..|.|...:    |..|    :|.||:  |..|..|..:.|   :::.......|||.||||
plant   224 -SLEWLQQELKI----PIYP----IGPLHMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGS 279

  Fly   298 NVLSKDLPADRKDLI--LKTFASLPQRVLWKFEDDKLPGK-------------PSNVFISKWFPQ 347
            ..|     .:.|:::  .....|..|..||......:.|.             |...:|.||.||
plant   280 FTL-----LETKEVLEMASGLVSSNQHFLWVIRPGSILGSELTNEELLSMMEIPDRGYIVKWAPQ 339

  Fly   348 PDILAHPKVKLFITHGGLLSTIESIHHGKPVLGLPFFYDQFLNVR 392
            ..:|||..|..|.:|.|..||:||:..|.|::..||..||.:|.|
plant   340 KQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNAR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 97/435 (22%)
MGT 26..438 CDD:273616 96/430 (22%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 97/435 (22%)
YjiC 8..433 CDD:224732 97/435 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.