DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:379 Identity:87/379 - (22%)
Similarity:132/379 - (34%) Gaps:102/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TSVNAFPQKKPVVNFRDVFIPDVF--NNYKELINELSGPMNLWQENNFINKFFVSVTR-CVLTNK 113
            |..|.....|.:.:|:.:.||:..  ::.|.|     ||  :|        |.:.:.: |.::.|
plant    20 TKFNYLNPSKDLADFQFITIPESLPASDLKTL-----GP--IW--------FIIKLNKECEISFK 69

  Fly   114 EVTETLLPPGKDHFDLIIVEALRSDAYYGFAA--HFNAPIIGIST---------------FGTD- 160
            :.....|...::....:|.:..   .|:..||  .||.|.:..||               :..| 
plant    70 KCLGQFLLQQQEEIACVIYDEF---MYFAEAAAKEFNLPKVIFSTENATAFACRSAMCKLYAKDG 131

  Fly   161 --------WNIDALVGNESPLSYTPLATGGLTDRMTFLERLSNFVDTTVAWLNYRFVHMSEQEKM 217
                    ...:.||....||.|..|.|.....           |:.:|.      |..|..||.
plant   132 IAPLTEGCGREEELVPELHPLRYKDLPTSAFAP-----------VEASVE------VFKSSCEKG 179

  Fly   218 YAKYFPEASKRVQLTDLNRNFSLVLLNQHFSLSFPRPYVPNMIEVGGLHI--SHKPAPLPKDLE- 279
            .|     :|..:.........||..|.|...:    |..|    :|.|::  |..|..|..:.| 
plant   180 TA-----SSMIINTVSCLEISSLEWLQQELKI----PIYP----IGPLYMVSSAPPTSLLDENES 231

  Fly   280 --EFIQGSGEHGVIYFSLGSNVLSKDLPADRKDLI--LKTFASLPQRVLWKFEDDKLPGK----- 335
              :::.......|||.||||..|     .:.|:::  .....|..|..||......:.|.     
plant   232 CIDWLNKQKPSSVIYISLGSFTL-----LETKEVLEMASGLVSSNQYFLWAIRPGSILGSELSNE 291

  Fly   336 --------PSNVFISKWFPQPDILAHPKVKLFITHGGLLSTIESIHHGKPVLGL 381
                    |...:|.||..|..:|||..|..|.:|.|..||:|||..|.|::||
plant   292 ELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 87/379 (23%)
MGT 26..438 CDD:273616 87/379 (23%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 85/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.