DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:368 Identity:71/368 - (19%)
Similarity:124/368 - (33%) Gaps:119/368 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RCVLTNKEVTETLLPPGKDHFDLIIVEALRSD------AYYG-----FAAHFNAPII----GIST 156
            :|:||             |.|..:..|...::      ||||     ..||.....|    |:..
plant   114 KCILT-------------DAFLWLAAETAAAEMKASWVAYYGGGATSLTAHLYTDAIRENVGVKE 165

  Fly   157 FGTDWNIDALVGNESPLSYTPLATGGLTDRMTFLERLSNFVDTTVAWLNYRFVHMSEQEKMYAKY 221
            .|                                ||:    :.|:.::       |..||:..| 
plant   166 VG--------------------------------ERM----EETIGFI-------SGMEKIRVK- 186

  Fly   222 FPEASKRVQLTDLNRNFSLVLLNQHFSLSFPR-------------PYVPN--------MIEVGGL 265
              :..:.|...:|:..||..|  ....|:.||             |...|        .:.:|.|
plant   187 --DTQEGVVFGNLDSVFSKTL--HQMGLALPRATAVFINSFEELDPTFTNDFRSEFKRYLNIGPL 247

  Fly   266 HISHKPAPL------PKDLEEFIQGSGEHGVIYFSLGSNVLSKDLPADRKDLILKTFASLPQRVL 324
            .:...|:..      |.....:|:......|.|.:.|.....   |......|.:...|.....:
plant   248 ALLSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFGRVATP---PPVELVAIAQGLESSKVPFV 309

  Fly   325 WKFEDDKLPGKPSNVFISK---------WFPQPDILAHPKVKLFITHGGLLSTIESIHHGKPVLG 380
            |..::.|:...|.. |:.:         |.||.::|.|..:.:|::|||..|.:||:..|.|::.
plant   310 WSLQEMKMTHLPEG-FLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMIC 373

  Fly   381 LPFFYDQFLNVRRATQAGFGLG--LDHTTMTQQELKETIEILL 421
            .|.|.|..:|. |:.:|.:.:|  :.....|:...:|:::.:|
plant   374 RPIFGDHAINA-RSVEAVWEIGVTISSGVFTKDGFEESLDRVL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 71/368 (19%)
MGT 26..438 CDD:273616 71/368 (19%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 71/368 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.