DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT73B1

DIOPT Version :10

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_567955.1 Gene:UGT73B1 / 829561 AraportID:AT4G34138 Length:488 Species:Arabidopsis thaliana


Alignment Length:139 Identity:32/139 - (23%)
Similarity:50/139 - (35%) Gaps:33/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAGAVREGLELKKVETTEKNVL---PTKEDVAE-------EKQHVERIHEIEHFDSTKLHSTPVK 68
            :.|:...||.|..:...||||.   .|.|.:.|       |.|:....||....|        :.
plant  1990 ICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGID--------II 2046

  Fly    69 EKIVLPSADDIKQEKQHLELTDKIN-----------NFPSENLKKTETIEKNVLPSP-TDVAREK 121
            ..::|...:.:.:::..|.|..|.|           ...|||   .|.|..|:.|.. .:|.::.
plant  2047 TALILNDINPLGRKRMDLVLELKNNASKLLLAIMESRHDSEN---AERILYNMRPKELVEVIKKA 2108

  Fly   122 TLQMAASFD 130
            .||....|:
plant  2109 YLQGEVEFE 2117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 Glycosyltransferase_GTB-type <171..482 CDD:471961
UGT73B1NP_567955.1 PLN03007 5..482 CDD:178584
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.