DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:186 Identity:52/186 - (27%)
Similarity:78/186 - (41%) Gaps:38/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SGEHG-VIYFSLGS---------NVLSKDLPADRKDLI--LKTFASLPQRVLWKFE---DDKLPG 334
            |.|.| |:|..|||         ..|...|.|..|..|  ::.:........|..:   ::::  
plant   278 SQETGSVLYVCLGSLCNLPLAQLKELGLGLEASNKPFIWVIREWGKYGDLANWMQQSGFEERI-- 340

  Fly   335 KPSNVFISKWFPQPDILAHPKVKLFITHGGLLSTIESIHHGKPVLGLPFFYDQFLNVRRATQ--- 396
            |...:.|..|.||..||:|..:..|:||.|..||:|.|..|.|:|..|.|.:||||.:...|   
plant   341 KDRGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGITAGVPLLTWPLFAEQFLNEKLVVQILK 405

  Fly   397 AGFGLGLDHTTMTQQELKETIEILLK----EPRFAQIARQMSERYRDQPMSPLDTA 448
            ||..:|              :|.|:|    |...|.::|:...:..|:.|...:.|
plant   406 AGLKIG--------------VEKLMKYGKEEEIGAMVSRECVRKAVDELMGDSEEA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 52/186 (28%)
MGT 26..438 CDD:273616 49/174 (28%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 52/186 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.