DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:273 Identity:53/273 - (19%)
Similarity:103/273 - (37%) Gaps:68/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QEKMYAKYFPEASKRVQLT---------DLNRNFSLVLLNQHFSLSFPRPYVPNMIEVGGLHISH 269
            :.|.:..:|...::|.:.|         ||.......|.|.:...::|...:.::..|...::..
plant   187 KSKEWLTFFVTQARRFRETKGILVNTVPDLEPQALTFLSNGNIPRAYPVGPLLHLKNVNCDYVDK 251

  Fly   270 KPAPLPKDLEEFIQGSGEHGVIYFSLGS-------NVLSKDLPADRKDLILKTFASLPQRVLWKF 327
            |.:.:.:.|:|    .....|::...||       .|....|..||..          .|.||..
plant   252 KQSEILRWLDE----QPPRSVVFLCFGSMGGFSEEQVRETALALDRSG----------HRFLWSL 302

  Fly   328 ED------DKLPGKPSNV-------FISK---------WFPQPDILAHPKVKLFITHGGLLSTIE 370
            ..      .:.||:.:|:       |..:         |..|..|||.|.:..|::|||..||:|
plant   303 RRASPNILREPPGEFTNLEEILPEGFFDRTANRGKVIGWAEQVAILAKPAIGGFVSHGGWNSTLE 367

  Fly   371 SIHHGKPVLGLPFFYDQFLNVRRATQAGFGLGLD-------------HTTMTQQELKETIEILLK 422
            |:..|.|:...|.:.:|..|.....:. .||.::             ...:|.:|:::.|..|::
plant   368 SLWFGVPMAIWPLYAEQKFNAFEMVEE-LGLAVEIKKHWRGDLLLGRSEIVTAEEIEKGIICLME 431

  Fly   423 EPRFAQIARQMSE 435
            :.  :.:.::::|
plant   432 QD--SDVRKRVNE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 53/273 (19%)
MGT 26..438 CDD:273616 53/273 (19%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 53/273 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.