DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and UGT73C2

DIOPT Version :10

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_181214.1 Gene:UGT73C2 / 818248 AraportID:AT2G36760 Length:496 Species:Arabidopsis thaliana


Alignment Length:163 Identity:35/163 - (21%)
Similarity:58/163 - (35%) Gaps:51/163 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGLELKKVETTEKNVLPTKEDVAEEKQHVER--------IHEIEHFDST---------KLHS--- 64
            |.:.::..:.::|.:..|:...:||.|...:        :..||:.:.|         .|||   
plant   762 EKVVMRNKDKSQKTISNTETRPSEEPQSPSKTKHKNKRSLDPIENINGTVQNALKKIGNLHSDKK 826

  Fly    65 -TPVKEKIVLPSADDIKQEKQHLELTDKINNFPSE--------------NLKKTETIE------- 107
             |.|||....|.....:.|..|       .:||||              :|.:.||..       
plant   827 TTEVKEAPKTPDHSKSRSEVLH-------PHFPSEAASLLAAQLKEKTQSLNRVETSSNHNGIGP 884

  Fly   108 -KNVLPSPTDVAREKTLQMAASFDKSALHHVET 139
             |:....||...:.|. .:||...||:..::.|
plant   885 IKSQKEKPTPPQKAKR-SVAAINQKSSKPNLPT 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 Glycosyltransferase_GTB-type <171..482 CDD:471961
UGT73C2NP_181214.1 Glycosyltransferase_GTB-type 13..495 CDD:471961
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.