DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:199 Identity:41/199 - (20%)
Similarity:65/199 - (32%) Gaps:77/199 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 LVLLNQHFSLSF-------------PRPYVPNMIEVGGLHISHKPAPLPKDLEEFIQGSGEHGVI 291
            |...|.||:|:.             |...|..:....||     |...|:|.|...:...:    
plant    32 LARTNLHFTLATIESARDLLSSTDEPHSLVDLVFFSDGL-----PKDDPRDHEPLTESLRK---- 87

  Fly   292 YFSLGSNVLSKDLPADRKDLILKT-FA----------SLPQRVLW-------------------- 325
               :|:|..||.:...|.|.|:.. |.          ::|..:||                    
plant    88 ---VGANNFSKIIEGKRFDCIISVPFTPWVPAVAAAHNIPCAILWIEACAGFSVYYRYYMKTNSF 149

  Fly   326 -KFEDD----KLPGKPSNVFISKWFPQPDILAHPKVKLFITHGGLLST-----IESIHHGKPVLG 380
             ..||.    :|||.|   |:       ::...|.:.| .:||.:.:|     :|.:...|.||.
plant   150 PDLEDPNQKVELPGLP---FL-------EVRDLPTLML-PSHGAIFNTLMAEFVECLKDVKWVLA 203

  Fly   381 LPFF 384
            ..|:
plant   204 NSFY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 41/199 (21%)
MGT 26..438 CDD:273616 41/199 (21%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.