DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:187 Identity:37/187 - (19%)
Similarity:73/187 - (39%) Gaps:60/187 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRIG-FLLLT-LPASMQAARILAIFPFPGPS--QYINVVPYLKELANRGHQVTSVNAFPQKKPVV 64
            :|:| |:.|: |.....:::||...|..|.|  ::|:.|..:  :|:.||.||            
 Worm     1 MRLGTFIFLSILFFKCHSSKILIFNPIYGFSHVKFISKVADI--IADHGHHVT------------ 51

  Fly    65 NFRDVFIPDVFNNYKELINELSGPMNLWQENNFINKFFVSVTRCVLTNKEVTETLLPPGKDHFDL 129
                     :|..|...:..|.|                     ::.||.:  .:|.....|:: 
 Worm    52 ---------LFQPYHIALKNLDG---------------------LVKNKNI--EILNYHPTHYE- 83

  Fly   130 IIVEALRSDAYYGFAAHFNAPIIGISTFGTDWNIDALVGNESPLSYTPLATGGLTDR 186
               |.|:::. ..|:..:::.::|....|. :.:..|:|.|..::    |...|:||
 Worm    84 ---ELLKAEP-QAFSFFWDSHLVGNPVIGA-FLMPKLIGGEFKIT----AMEVLSDR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 egt 8..466 CDD:223071 35/182 (19%)
MGT 26..438 CDD:273616 30/163 (18%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.