DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35B1 and Ugt2b37

DIOPT Version :10

Sequence 1:NP_524313.2 Gene:Ugt35B1 / 41333 FlyBaseID:FBgn0026314 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_444445.2 Gene:Ugt2b37 / 112417 MGIID:2148239 Length:530 Species:Mus musculus


Alignment Length:117 Identity:30/117 - (25%)
Similarity:54/117 - (46%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LPKMNQELAGAVREGLELKKVETTEKNVLPTKEDVAEEKQHVERIHEIEHFDSTKLHSTPVKEKI 71
            |.|:..|||       |.|::...::..|...:|  :||...|.|..:.. :|.|      |||:
Mouse   632 LSKLQDELA-------ETKRLLEEKREQLRKSKD--QEKALEEEIEALRQ-ESKK------KEKM 680

  Fly    72 VLPSADDIKQEKQHL--ELTDKINNFPSENLKKTETIEKNVLPSPTDVAREK 121
            .......:::||::|  ||:...:...| ::.|....:|.:....|::||:|
Mouse   681 AKEQLRKLEEEKENLQAELSSCSSQLDS-SINKYNNSQKVIQELNTEIARQK 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35B1NP_524313.2 Glycosyltransferase_GTB-type <171..482 CDD:471961
Ugt2b37NP_444445.2 UDPGT 24..527 CDD:278624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.