DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and ICME-LIKE1

DIOPT Version :10

Sequence 1:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_173937.2 Gene:ICME-LIKE1 / 839153 AraportID:AT1G26120 Length:476 Species:Arabidopsis thaliana


Alignment Length:110 Identity:31/110 - (28%)
Similarity:55/110 - (50%) Gaps:17/110 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RLNVY-TKDLKGRRPVIVFLHPGGFYVFSGQSKYLAGPEHFMDRDCVLVSLNYR---LGSLGFLA 160
            ||::| .|:..|.:||:.|:..|.:.:.......|.| :...:||.::..::||   .||:..: 
plant   193 RLDLYLPKNSTGPKPVVAFVTGGAWIIGYKAWGSLLG-QQLSERDIIVACIDYRNFPQGSISDM- 255

  Fly   161 TGSKEAPGNAGLKDQVLALRWIQQHIQRFGGDPDSVTLLGYSAGS 205
                       :||....:.::..||..:|||||.:.|:|.|||:
plant   256 -----------VKDASSGISFVCNHIAEYGGDPDRIYLMGQSAGA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_650043.1 COesterase 20..540 CDD:395084 31/110 (28%)
ICME-LIKE1NP_173937.2 Aes 195..441 CDD:440422 29/108 (27%)

Return to query results.
Submit another query.