DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and AT2G45610

DIOPT Version :10

Sequence 1:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_182085.1 Gene:AT2G45610 / 819169 AraportID:AT2G45610 Length:324 Species:Arabidopsis thaliana


Alignment Length:77 Identity:17/77 - (22%)
Similarity:29/77 - (37%) Gaps:25/77 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLSLILMQQTVVATGKQCMDIITIRNNENDTITPKIFYYEGAGQQIAEISCAGETSGVVELISND 75
            |.||.|:|.| :...:|.:|..::.            .|:..|....|:|.            ::
plant   674 VYSLTLLQAT-LHKYEQALDKCSVE------------VYKKVGMLYPEMSV------------HE 713

  Fly    76 RSLGVIEDRSHK 87
            |||..:.:..||
plant   714 RSLDFLIELLHK 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_650043.1 COesterase 20..540 CDD:395084 12/68 (18%)
AT2G45610NP_182085.1 Abhydrolase_3 82..302 CDD:400284
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.