DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and AT2G45600

DIOPT Version :10

Sequence 1:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_566047.1 Gene:AT2G45600 / 819168 AraportID:AT2G45600 Length:329 Species:Arabidopsis thaliana


Alignment Length:99 Identity:22/99 - (22%)
Similarity:38/99 - (38%) Gaps:28/99 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FTFNVLSLILMQQTVV----------ATGKQCMDIITIRNNENDTITPKIFYYEGAGQQIAEISC 61
            |:||:..:..:.:..|          ..||..:.:::|:|.|......|       .:|:     
plant   597 FSFNIKDIHSVLEVTVYDEDRDRSADFLGKVAVPLLSIQNGEQKAYVLK-------NKQL----- 649

  Fly    62 AGETSGV----VELISN--DRSLGVIEDRSHKAI 89
            .|.|.||    |::|.|  ...||.:..:..|.|
plant   650 TGPTKGVIYLEVDVIFNAVKACLGSLVPKEQKYI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_650043.1 COesterase 20..540 CDD:395084 19/86 (22%)
AT2G45600NP_566047.1 Abhydrolase_3 69..295 CDD:400284
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.