DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and alpha-Est8

DIOPT Version :9

Sequence 1:NP_001262469.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster


Alignment Length:559 Identity:169/559 - (30%)
Similarity:247/559 - (44%) Gaps:124/559 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DTELGRVRGANLTSRLGVNFHAFRGIRYAEPPLGDLRFVNPQPVKPWSPKIFDASEDGPMCPQPW 88
            ||..|:|:|....|..|.|:::|.||.:|:||:|:|||..|...:.||    |......:..:|.
  Fly    36 DTVYGKVKGVKWQSIYGNNYYSFEGIPFAKPPVGELRFKAPVEPEHWS----DVKRCTHVRAKPC 96

  Fly    89 D-----NMTDVSEDCLRLNVYTKDLKGRR--PVIVFLHPGGFYVFSGQ-SKYLAGPEHFMDRDCV 145
            .     .....|||||.|||||::|...|  ||:|:::.|||.:  |: |:.|..|::.|....|
  Fly    97 QVNIVLKQVQGSEDCLYLNVYTRELHPHRPLPVLVWIYGGGFQM--GEASRDLYSPDYIMMEHVV 159

  Fly   146 LVSLNYRLGSLGFLATGSKE--APGNAGLKDQVLALRWIQQHIQRFGGDPDSVTLLGYSAGSISV 208
            ||.::||||:||||:...:|  .||||||||||:||||::::.|.||||||::|:.|.|||..|.
  Fly   160 LVVISYRLGALGFLSLADEELDVPGNAGLKDQVMALRWVKRNCQFFGGDPDNITVFGESAGGAST 224

  Fly   209 ALHMLSPMSRGLFHRGICMSAA--------------PY---------GPVKYKDNDLQLAKRQAG 250
            ...||:..::||||:.|.||.:              ||         |....:|....|.|.:|.
  Fly   225 HYMMLTDQAKGLFHKTIIMSGSALAPWAQTPTHINWPYRLAQATGYTGDANDRDIFAHLKKCKAS 289

  Fly   251 LLKCPQESIGEMVECMRRKPYLDYVSTYNGMFEFG--WNPVLNWRIVVEKDFGQERYLIESPFKT 313
            .:....|.|..|.|..:|..          ||.||  ..|.|....|:.|          ||.:.
  Fly   290 SMLKVAEDIITMEERHQRLT----------MFSFGPTIEPYLTPHCVIPK----------SPLEM 334

  Fly   314 ARRGDFHKVALITGITEFEFLSGAFFDLRNESIVNRYNR------DWEHYASIALLLEQNSTQSR 372
            .|....:.:.::.|...||.|  ..|     ..||::..      |.|:.|.....:::.  |.:
  Fly   335 MRDCWGNSIPMVIGGNSFEGL--LMF-----PEVNKWPELLCQLGDCENLAPQDAHVDEQ--QRK 390

  Fly   373 AASRVFREKYMPESLDKLEYPKSLKGMGELLSDALIGVSFHRFLQLMSPHTPIY-TYLFRYK--- 433
            |..:..||.|..   |:....|::....:|.|........||.|...:.|.|:. |:|:|:.   
  Fly   391 AFGKKVRELYFG---DRTPGRKTILEYSDLFSYKYFWHGIHRTLLSRAHHAPLAPTFLYRFDFDS 452

  Fly   434 -----------GRYTFLKNPDNQQTIGPVHHDELIYLFHVGLLIPLLKREDPENFMIELLTRMWI 487
                       ||          :..|..|.|:|.|||: ......|||...|...|:.|..|.:
  Fly   453 KHFNIMRIITCGR----------KVRGTCHADDLSYLFY-NAAAKKLKRRTAEFKTIKRLVSMVV 506

  Fly   488 EFAQKGDPH-------------------NKNDEYLKGLN 507
            .||..|||:                   :|:|:..:.||
  Fly   507 HFAISGDPNIPMVCQDEKEQPRGAWLPISKDDKVFQCLN 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_001262469.1 COesterase 15..540 CDD:278561 169/559 (30%)
Aes 40..>204 CDD:223730 76/173 (44%)
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 169/559 (30%)
Aes <116..>221 CDD:223730 53/106 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467389
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
87.790

Return to query results.
Submit another query.