DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and LOC1276426

DIOPT Version :10

Sequence 1:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_315770.5 Gene:LOC1276426 / 1276426 VectorBaseID:AGAMI1_000772 Length:579 Species:Anopheles gambiae


Alignment Length:62 Identity:15/62 - (24%)
Similarity:24/62 - (38%) Gaps:16/62 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFFTFNVLSLILMQQTVVATGKQCMDIITIRNNENDTITPKIFYYEGAGQQIAEISCAGETS 66
            |...|:|....|:.||:              ::.:.:||.  ..:.|||.....|||..:.|
Mosquito   537 LIHVFDVAQNYLLLQTL--------------DDHSSSITS--IKFVGAGLNFQMISCGADKS 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_650043.1 COesterase 20..540 CDD:395084 10/47 (21%)
LOC1276426XP_315770.5 None

Return to query results.
Submit another query.