DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and AADACL3

DIOPT Version :10

Sequence 1:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001096640.2 Gene:AADACL3 / 126767 HGNCID:32037 Length:407 Species:Homo sapiens


Alignment Length:150 Identity:34/150 - (22%)
Similarity:62/150 - (41%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PKIFDASEDGPMCPQPWDN---MTDVSEDCLRLNVY-----TKDLKGRRPVIVFLHPGGFYVFSG 128
            |:.|...:|.|  |..:|.   :||.....:.:.:|     |..||   |.||:.|.||..:.|.
Human    69 PQFFCFMQDLP--PLKYDPDVVVTDFRFGTIPVKLYQPKASTCTLK---PGIVYYHGGGGVMGSL 128

  Fly   129 QSKYLAGPEHFMDRDCVLVSLNYRLGSLGFLATGSKEAPGN---AGLKDQVLALRWIQQHIQRFG 190
            ::.:........:.|.|::::.||            :.|.:   ..::|.::|.....:.:..:|
Human   129 KTHHGICSRLCKESDSVVLAVGYR------------KLPKHKFPVPVRDCLVATIHFLKSLDAYG 181

  Fly   191 GDPDSVTLLGYSAGSISVAL 210
            .||..|.:.|.|.|....|:
Human   182 VDPARVVVCGDSFGGAIAAV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_650043.1 COesterase 20..540 CDD:395084 34/149 (23%)
AADACL3NP_001096640.2 Abhydrolase_3 115..378 CDD:400284 21/98 (21%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 1/1 (100%)

Return to query results.
Submit another query.