DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and LOC107987423

DIOPT Version :9

Sequence 1:NP_001262469.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:322 Identity:79/322 - (24%)
Similarity:128/322 - (39%) Gaps:91/322 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 MVECMRRKPYLDYVSTYNGMFEFGWN---------PVLNWRIVVEKDFGQERYLIESPFKTARRG 317
            ||.|:|:|...:.:.|...|.....:         |:|...|       ....|:::|.:.....
Human     1 MVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVI-------DGMLLLKTPEELQAER 58

  Fly   318 DFHKVALITGITEFEF------------LSGAFFDLRNE-SIVNRYNRDWEHYASIALLLE--QN 367
            :||.|..:.||.:.||            ||....|.:.. |::      |:.|..:.:..|  ..
Human    59 NFHTVPYMVGINKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLL------WKSYPLVCIAKELIPE 117

  Fly   368 STQSRAASRVFREKYMPESLDKLEYPKSLKGMGELLSDALIGVSF------HRFLQLMSPHTPIY 426
            :|          |||:..:.|.:: .|.|  ..:|::|.:.||..      ||     ....|.|
Human   118 AT----------EKYLGGTDDTVK-KKDL--FLDLIADVMFGVPSVIVARNHR-----DAGAPTY 164

  Fly   427 TYLFRYKGRYTFLKNPDNQQTIGPVHHDELIYLFHVGLLIPLLKR--EDPENFMIELLTRMWIEF 489
            .|.|:|:..::....|   :|:...|.|||..:|..    |.||.  .:.|..:.:::.:.|..|
Human   165 MYEFQYRPSFSSDMKP---KTVIGDHGDELFSVFGA----PFLKEGASEEEIRLSKMVMKFWANF 222

  Fly   490 AQKGDPHNKNDEYLKGL-NWPLYNAQDKGYLEIGNNLTA------KSGGFFLNRYQIWEDLF 544
            |:.|:|:.      :|| :||.|| |.:|||:||.|..|      |...|       |.:||
Human   223 ARNGNPNG------EGLPHWPEYN-QKEGYLQIGANTQAAQKLKDKEVAF-------WTNLF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_001262469.1 COesterase 15..540 CDD:278561 76/316 (24%)
Aes 40..>204 CDD:223730
LOC107987423XP_016885725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.