DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4757 and CEL

DIOPT Version :9

Sequence 1:NP_001262469.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens


Alignment Length:585 Identity:160/585 - (27%)
Similarity:244/585 - (41%) Gaps:106/585 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LMLFVVELLVLLASSSVLSI-EVDTELGRVRGAN-LTSRLGVNFHAFRGIRYAEPPLGDLRFVNP 64
            |.|.|:.|....|.:|...: .|.||.|.|.|.| ....||.:...|:||.:|.|...   ..||
Human     4 LQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKA---LENP 65

  Fly    65 QPVKPWSPKIFDASEDGPMCPQP--WDNMTDVSEDCLRLNVYTKDLKGRR------PVIVFLHPG 121
            ||...|...: .|......|.|.  ..:.|...||||.||::..  :||:      ||:::::.|
Human    66 QPHPGWQGTL-KAKNFKKRCLQATITQDSTYGDEDCLYLNIWVP--QGRKQVSRDLPVMIWIYGG 127

  Fly   122 GFYVFSGQ-----SKYLAGPEHFMDR-DCVLVSLNYRLGSLGFLATGSKEAPGNAGLKDQVLALR 180
            .|.:.||.     :.||...|....| :.::|:.|||:|.||||:||....|||.||:||.:|:.
Human   128 AFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIA 192

  Fly   181 WIQQHIQRFGGDPDSVTLLGYSAGSISVALHMLSPMSRGLFHRGICMSAAPYGPVKYKDNDLQLA 245
            |::::|..|||||:::||.|.|||..||:|..|||.::||..|.|..|.....|...:.|.|..|
Human   193 WVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWA 257

  Fly   246 KRQAGLLKCPQESIGEMVECMR------------------RKPYLDYVSTYNGMFEFGWNPVLNW 292
            |:.|..:.||......|.:|::                  ..|.|.||         |:.||:: 
Human   258 KKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYPMLHYV---------GFVPVID- 312

  Fly   293 RIVVEKDFGQERYLIESPFKTARRGDF---HKVALITGITEFEFLSGA------FFDLRNESIVN 348
                                    |||   ..:.|.....:.::::|.      .|...:...:|
Human   313 ------------------------GDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAIN 353

  Fly   349 RYNRDWEHYASIALLLEQNSTQSRAASRVFREKYMPESLDKLEYPKSLKGMGELLSDAL------ 407
            :.|:.........|:.|...|:....::...:.|..............|.:.:..:|.|      
Human   354 KGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTE 418

  Fly   408 IGVSFHRFLQLMSPHTPIYTYLFRYKGRYTFLKNPDNQQTIGPVHHDELIYLFHVGLLIPLLKRE 472
            |.::.|| ....|..|  |.|||.:..|.     |...:.:|..|.|::.|:|......|...| 
Human   419 IALAQHR-ANAKSAKT--YAYLFSHPSRM-----PVYPKWVGADHADDIQYVFGKPFATPTGYR- 474

  Fly   473 DPENFMI-ELLTRMWIEFAQKGDPHNKNDEYLKGLNWPLYNAQDKGYLEIGNNLTAKSGGFFLNR 536
             |::..: :.:...|..||:.||| |..|..:. .:|..|..::.|||||    |.|.|...:.|
Human   475 -PQDRTVSKAMIAYWTNFAKTGDP-NMGDSAVP-THWEPYTTENSGYLEI----TKKMGSSSMKR 532

  Fly   537  536
            Human   533  532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4757NP_001262469.1 COesterase 15..540 CDD:278561 155/572 (27%)
Aes 40..>204 CDD:223730 63/177 (36%)
CELNP_001798.3 Heparin-binding 21..121 32/105 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.