DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ART5

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_011582.1 Gene:ART5 / 852960 SGDID:S000003300 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:441 Identity:88/441 - (19%)
Similarity:157/441 - (35%) Gaps:133/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VTGKGKCKWMEILRKNS----------NNNEYSRS---------LFYTSKEVYE-HSETPLPDFE 88
            |||..    .|.||:|:          |||.:|.|         ||...:..|| ...|.||...
Yeast   185 VTGTP----FEGLRENARSRSSSSNTLNNNSHSYSNRDGSGSSYLFLMKRGNYELPFNTMLPPEV 245

  Fly    89 PRGLE-LSAGEHTFIFEVAL-GRQL-------PSSFKGSYGA-------IKYKMRVLIQRPWTFD 137
            ...:| |.:|...:.||..: ||||       .:|..|..|:       ::.|.:::|::   |.
Yeast   246 CETIEGLQSGSILYSFEAIIDGRQLWDTDLSVHTSPHGPIGSTSTSGNGMRTKNKIIIKK---FK 307

  Fly   138 ERHTIPFTVVKNMPLQ-------------PMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDF 189
            ....:....:.|:.:|             ..:.||||       :.:.:..|.|:. :.:.|.:.
Yeast   308 YLRILRTLSMDNLAMQEEISVGNTWRDKLQYETSIPS-------RAVPIGSTTPVK-IKIFPFEK 364

  Fly   190 AVRGEPLRICATVINNSTTAVEKLRFTVLQY-------VTYYSHVPLRVQKVECIAVATKETGSV 247
            .:|                 ::::...::||       ...|.. .:.|.|:..:|    :.|.:
Yeast   365 NIR-----------------LDRIEMALIQYYAMKDSSAQIYDD-EIAVMKITHLA----DFGPL 407

  Fly   248 QKKTERSFAHELLLPDGAQPTDEQ---MSGVITIVYELRVEAVLR----GFFKNLIL-------- 297
            ..|.:...  ...:||..:...:.   ...:|.::::|:|..:|:    |.:|||.:        
Yeast   408 TDKLDVDC--PFTIPDNLKQITQDCCLQDNLIRVMHKLQVRILLQRQVDGEYKNLEIKAQLPMLL 470

  Fly   298 ----NLPFK--VYSQDPSNRQSSLRPPP------PPRPNDG-PPGPELGSGNLFEPALPVYPSLD 349
                :||.|  :...|..:.:...||..      ...|..| .||.||.|......|||..|   
Yeast   471 FISPHLPMKGRLVLFDKHDGKIHFRPGELVPLFLTTYPAQGLTPGVELNSTTTAHLALPQPP--- 532

  Fly   350 SSIGSPSHSSQFSE--CSSINSITSDSSAATLSPAVGAGTGGMDMSYTSGS 398
                 |::....::  ..::..:.:||...|:.....|.......||.:||
Yeast   533 -----PNYHESTNDHLMPALQPLGADSVVLTVPSYEQAQAQASASSYVTGS 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 35/143 (24%)
Arrestin_C 178..305 CDD:280848 24/154 (16%)
ART5NP_011582.1 Arrestin_C 332..475 CDD:397050 26/174 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.