DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ART10

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_013496.3 Gene:ART10 / 851108 SGDID:S000004384 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:28/121 - (23%)
Similarity:51/121 - (42%) Gaps:39/121 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TDEQMSGVITIVYEL-------RVEAVLRGFFKNLILNLPFKVYSQDPSNRQSSLRPPPPPRPND 325
            :::||||::::  :|       ::..:|:||.:.|.     |: .|:...:|:.:..|       
Yeast    20 SNDQMSGIVSL--QLTKALSIRKISVILKGFSETLT-----KI-DQEYMFQQNGMMMP------- 69

  Fly   326 GPPGPELGSGNLFE----PALPVYPSLDSSI-------GSPSHSSQFS------EC 364
            |.......:...||    |...|:.:||.|.       ||.::|.||.      ||
Yeast    70 GQDNKSFHTLMKFEQRVFPPDNVWNALDGSSKPFKVKPGSYNYSFQFDKFPRKPEC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627
Arrestin_C 178..305 CDD:280848 10/43 (23%)
ART10NP_013496.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.