DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and LOC799768

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_009300042.3 Gene:LOC799768 / 799768 -ID:- Length:377 Species:Danio rerio


Alignment Length:382 Identity:89/382 - (23%)
Similarity:159/382 - (41%) Gaps:75/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRITLD--SADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRS 68
            ||:..|  :....:.:|||:.|.:.:.|.|...:.::.|:.||..|..|.|...|..::..|   
Zfish    31 LRLQYDQINESNTFNSGDIVEGRVLLEVTKNLTVDSLFVKFTGGAKVYWTEGESKYHDHERY--- 92

  Fly    69 LFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQ-LPSSFKGSYGA----IKYKMRV 128
             |...:::     ||....:.|.: :|.|.|...|:..|..| ||.|||.....    |:|.:..
Zfish    93 -FKLKQDL-----TPGRSGKERQI-ISPGRHVLPFKFQLPEQNLPPSFKEKVSGFNCWIRYALTA 150

  Fly   129 LIQRPW-----TFDERHTIPFTVVKN-MPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPE 187
            .::||:     .:.|...:|.:.|.| ..|:|..|:         .|..:.|.:..|:|.|...:
Zfish   151 KLKRPFKSASTAYAELTFVPRSHVTNDHLLKPQNRT---------DKMKNTFSSGKISLTATTDK 206

  Fly   188 DFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKT- 251
            ...:.||.:::|.. |:|:::...||:::            |:.|::...:..||.:..:.::| 
Zfish   207 TGYMLGETIKVCVD-IDNASSRDAKLKYS------------LKQQQMFIASRTTKRSKHIIQETS 258

  Fly   252 -------ERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYS---- 305
                   :|.|...:.||.....:.|... :|.::|.|:|...: .|..:..:..|..:..    
Zfish   259 DCIPSGEKRRFLVNIKLPRDIMVSFENCR-IIRVLYLLKVSLDV-SFASDPAVKFPVVIIPPLQQ 321

  Fly   306 ----QDPSNRQSSLRPPP--PPRPNDGPPGPELGSGNLFEPALPVYPSLDSSI-GSP 355
                |||        |||  ||:|...|.|.......|::| :|..|...:.: |||
Zfish   322 CPPWQDP--------PPPYMPPQPVPHPGGAPPPFARLYDP-VPPNPGAAAGLPGSP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 40/158 (25%)
Arrestin_C 178..305 CDD:280848 26/134 (19%)
LOC799768XP_009300042.3 Arrestin_N 39..158 CDD:328947 33/128 (26%)
Arrestin_C 194..319 CDD:308405 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579483
Domainoid 1 1.000 65 1.000 Domainoid score I10015
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.