DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc2

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_012821263.1 Gene:arrdc2 / 780156 XenbaseID:XB-GENE-946088 Length:418 Species:Xenopus tropicalis


Alignment Length:402 Identity:102/402 - (25%)
Similarity:159/402 - (39%) Gaps:99/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRITLD---SADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSR 67
            :..:||   |..:||.||:|:.|::.:.:.|..::.|::|...|.....|:| .|....|..||.
 Frog    25 ISFSLDLSPSVHKVYSAGEIVEGKVVLELCKELRVSALEVCGRGLATVHWLE-SRSVGMNTVYSD 88

  Fly    68 SLFYTSKEVY----EH------SETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAI 122
               :||.|.|    :|      :.|.||          ||.|.|.|...|...|.:||:|.:|::
 Frog    89 ---FTSYETYLRKRQHLIRDNGTLTMLP----------AGRHEFPFSFQLPETLVTSFEGKHGSV 140

  Fly   123 KYKMRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQ-------------------VT 168
            :|.::..:.|||...::....|||:     :|:..:.|..|..|                   ||
 Frog   141 RYWVKAKLHRPWCTVKKVKKEFTVI-----EPIDINTPDLLAPQAGSKEKIAHAWYCNLGHVSVT 200

  Fly   169 KTISLFGTRPITLLALLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQK 233
            ..|...|..|              ||.:.|.|.:.|.:|.||.. :..::|...:.:...::.:|
 Frog   201 AKIDRKGYTP--------------GEVIPIFAEIDNCTTRAVIP-KAAIIQSQAFVARGTMKQKK 250

  Fly   234 VECIAVATKETGSVQK-KTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLIL 297
               ..|||....:|.. |.|......|.:|. ..|:..|.. :|.:.|.|:|...:.| ..||:|
 Frog   251 ---SVVATLAGDAVPAGKRETWHGRALKIPP-LGPSILQCR-IIRVEYTLKVCVEIPG-SSNLVL 309

  Fly   298 NLPFKVYSQDP----SNRQSS-----------LRPPPPPRPNDGPPGPELGSGNLFEPALPVYPS 347
            .||. |....|    .:|.||           ||...|.:|.   |.|:..|....|.|      
 Frog   310 ELPL-VIGTIPLHPFGSRTSSVGSQYSVNLEWLRMTVPEQPE---PPPDYSSVVSEEEA------ 364

  Fly   348 LDSSIGSPSHSS 359
             :.::..|.|||
 Frog   365 -EHNLSPPHHSS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 45/158 (28%)
Arrestin_C 178..305 CDD:280848 32/127 (25%)
arrdc2XP_012821263.1 Arrestin_N 36..171 CDD:334019 43/153 (28%)
Arrestin_C 195..320 CDD:214976 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.