DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and Arrdc5

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_084075.1 Gene:Arrdc5 / 76920 MGIID:1924170 Length:325 Species:Mus musculus


Alignment Length:231 Identity:56/231 - (24%)
Similarity:96/231 - (41%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEVYE 78
            |.||.||.||.|::.:.:|.......:||::.|:|..:|.|.:   ....:|||.:...:|..|.
Mouse    14 DAVYLAGSIIDGQVVLTLNSTLVDPVVKVELVGRGYVEWNEEI---GETRDYSRDVICNNKADYV 75

  Fly    79 HSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKY----------------KMR 127
            |.....|   .:...|.||.|||.|...|..:|||:|....|.|.|                |:.
Mouse    76 HKTKTFP---IKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCLDREHILAKKKLY 137

  Fly   128 VLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVR 192
            :|:|....|.:|:.             .:.|:....||:|:......|.  ::|...:.::..|.
Mouse   138 LLVQGISEFRQRNL-------------SENSVSVEAEKKVSYNCCSQGW--VSLHVQMSKNTYVP 187

  Fly   193 GEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVP 228
            ||.:...:.:.|::...::.:.|.:..:|.|....|
Mouse   188 GEKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFTP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 42/153 (27%)
Arrestin_C 178..305 CDD:280848 9/51 (18%)
Arrdc5NP_084075.1 Arrestin_N 13..128 CDD:304627 37/119 (31%)
Arrestin_C 170..304 CDD:280848 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836036
Domainoid 1 1.000 63 1.000 Domainoid score I10247
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.