DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and Arrdc5

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001102878.1 Gene:Arrdc5 / 680452 RGDID:1591748 Length:325 Species:Rattus norvegicus


Alignment Length:342 Identity:75/342 - (21%)
Similarity:130/342 - (38%) Gaps:89/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEVYE 78
            |.||.||..|.|::.:.:|.......:||::.|:|..:|.|.:   ....:|||.:...:|..|.
  Rat    14 DAVYLAGSNIDGQVVLTLNSTLVDPVVKVELVGRGYVEWNEEI---GETRDYSRDVICNNKADYV 75

  Fly    79 HSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKY----------------KMR 127
            |.....|   .:...|.||.|||.|...|..:|||:|....|.|.|                ::.
  Rat    76 HKTKTFP---IKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCMGREHILAKKRLY 137

  Fly   128 VLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVR 192
            :|:|....|.:|         |:...|:  |:.:  ||:|:......|.  ::|...:.::..|.
  Rat   138 LLVQGISEFRQR---------NLSENPL--SVEA--EKKVSYNCCSRGW--VSLHVQMSKNTFVP 187

  Fly   193 GEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAH 257
            ||.:...:.:.|::...::.:.|.:..:|.|....|                 |.::: .|:.:.
  Rat   188 GEKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFTP-----------------SAERR-RRADSS 234

  Fly   258 ELL---------------------LP------DGAQPTDEQMSGVITIVYELRVEAVLRGFFKNL 295
            |||                     ||      .|:|..:     ::...|||.|...|......:
  Rat   235 ELLRQMANARIPAFNSTTVVSAFNLPLVLSVSSGSQENE-----IMRTSYELVVTIHLPWSLSTV 294

  Fly   296 ILNLPFKVYS--QDPSN 310
            ...||..:.|  :|.:|
  Rat   295 KAGLPIIITSAREDKAN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 41/153 (27%)
Arrestin_C 178..305 CDD:280848 25/153 (16%)
Arrdc5NP_001102878.1 Arrestin_N 13..124 CDD:419887 36/115 (31%)
Arrestin_C 170..304 CDD:397050 26/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.