DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ARRDC5

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001354118.1 Gene:ARRDC5 / 645432 HGNCID:31407 Length:350 Species:Homo sapiens


Alignment Length:336 Identity:68/336 - (20%)
Similarity:121/336 - (36%) Gaps:67/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEVYE 78
            ||:|.||..|:|::.:.:|.......:||::.|:|..:|.|   :...:.:|||::...:|..|.
Human    14 DRIYLAGSSIKGQVILTLNSTLVDPIVKVELVGRGYVEWSE---EAGASCDYSRNVICNNKADYV 75

  Fly    79 HSETPLP--------------------DFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIK 123
            |.....|                    ..:|.........|..:.. ....:|||:|...:|.:.
Human    76 HKTKTFPVEEMASRSVTQAGVQWHDLGSLQPPSRTFKLSSHLSLLS-TWNYRLPSTFTSKFGHVF 139

  Fly   124 Y----------------KMRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTIS 172
            |                :|.:|:|...||.:.             .|.|..:....|::|:....
Human   140 YFVQASCMGREHILAKKRMYLLVQGTSTFHKE-------------TPFQNPLFVEAEEKVSYNCC 191

  Fly   173 LFGTRPITLLALLPEDFAVRGEPLRICATVINNSTT-AVEKLRFTVLQYVTYYSHVP-----LRV 231
            ..||  :.|...:..:....||.: :..|.|||.|: .::.:.|.:..::.|....|     .|:
Human   192 RQGT--VCLQIQMERNTFTPGEKV-VFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAERRSRL 253

  Fly   232 QKVECI--AVATKETGSVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKN 294
            ...|.:  ...|..|.....|...:|...|||...:...|.:   ::...|||.....|.....:
Human   254 DSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQDGE---IMHTRYELVTTVHLPWSLTS 315

  Fly   295 LILNLPFKVYS 305
            |...:|..:.|
Human   316 LKAKVPIIITS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 34/173 (20%)
Arrestin_C 178..305 CDD:280848 27/134 (20%)
ARRDC5NP_001354118.1 Arrestin_N 13..146 CDD:328947 29/135 (21%)
Arrestin_C 192..326 CDD:308405 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145958
Domainoid 1 1.000 63 1.000 Domainoid score I10288
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.