DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG18747

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_652650.2 Gene:CG18747 / 59143 FlyBaseID:FBgn0042104 Length:418 Species:Drosophila melanogaster


Alignment Length:400 Identity:110/400 - (27%)
Similarity:175/400 - (43%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEVYEHSE 81
            ::||.:::|...:..::..:::|:.::|.|....||.|        .....:..|..:|.|..|.
  Fly    17 FYAGQLVKGCATLKCDRSKEVQAVLLKVVGYSITKWSE--------KSLGSTKLYVGREDYLSSN 73

  Fly    82 TPLPDFEPRG-------LELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPWTFDER 139
            |.|...|...       |.:.||.|::.|...|..|.||||:|.:|.|:|.::||:.|||.||:.
  Fly    74 TYLVGSEQNNTHNNTHRLTIEAGVHSYNFTCQLPYQCPSSFEGRHGCIRYIVKVLLIRPWKFDQA 138

  Fly   140 HTIPFTVVKNMPLQ---PMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEPLRICAT 201
            :|..|||:|.:.|.   |..:|...| |...|.......|.|:.|...||:...|.|:.:.:...
  Fly   139 YTKGFTVLKMLDLN
FDTPQLKSAAHS-EGYRTFCCGPCKTDPLKLELHLPQAGYVPGQKIPVTIV 202

  Fly   202 VINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLPDGAQ 266
            |:||:..||.::|.:::..|.|||..| ...:||.:.::..:..||.|:..||...:|.:| ...
  Fly   203 VVNNTAVAVSEIRLSLVMLVRYYSVSP-EHSRVERLIISRAKGESVLKQCTRSQTIDLPVP-STP 265

  Fly   267 PTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYS----------QDPSNRQS------SL 315
            ||..::|.:|.|.|:|.|||:::...:..::.:|..|.:          |.|..|.:      |.
  Fly   266 PTCVELSNLIQIAYQLEVEALVKSLREQQLMVMPVTVGTIPLAVSGIVVQQPPRRSAHYEGPDSR 330

  Fly   316 RPPPPPRP-----------------NDGPPGPE-----------------LGSGNLFEPALPVYP 346
            |.||...|                 :...|..|                 .|| |.|.|..||| 
  Fly   331 RNPPDELPMVTALESLPSDLASSAADSALPNYEESRHTQRGNINEEELHAFGS-NEFAPLYPVY- 393

  Fly   347 SLDSSIGSPS 356
                ||.||:
  Fly   394 ----SIPSPT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 43/141 (30%)
Arrestin_C 178..305 CDD:280848 38/126 (30%)
CG18747NP_652650.2 Arrestin_N 5..152 CDD:278754 43/142 (30%)
Arrestin_C 176..307 CDD:214976 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.