DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG18746

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster


Alignment Length:371 Identity:94/371 - (25%)
Similarity:160/371 - (43%) Gaps:42/371 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILR---KNSNNNEYSRSLFYT 72
            :::..:::||.:|.|::.:...|...::|:.:.:.|..:..|.:...   ..||...::..:.|.
  Fly    10 NNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYL 74

  Fly    73 SKEVYEHSETPLPD--FEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPWT 135
            :...|.|..:...:  .||       |..::.|...|....||||:|:.|.|:|.:.|...|||.
  Fly    75 ATRAYLHGSSSSIEVLIEP-------GTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWK 132

  Fly   136 FDERHTIPFTVVKNMPL--QPMQRSIPSSLEKQVTKTISLFGTR--PITLLALLPEDFAVRGEPL 196
            ||......|||:|.|.|  :.:...:||.:|.|  :|...|..|  |:::...:|:...|.|:.:
  Fly   133 FDLNFNRCFTVIKVMDLN
SESLMLRVPSQVESQ--RTFCCFPCRSSPLSMRLSVPQSGFVPGQIV 195

  Fly   197 RICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLL 261
            .:...|.|:|..|||.:...:...|.|||..|......:...:..|..|.|..|..:.|..:|.:
  Fly   196 PVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFDLKV 260

  Fly   262 PDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDPSNRQSSLRPPP-----PP 321
            |. ..||...:..:|.|.|::..||.::|......|::|..:.|. |..:|....|..     ||
  Fly   261 PP-TPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSV-PLTKQLQKEPRTWGEVLPP 323

  Fly   322 RPNDGPP---------GPELGSGNLFEPALPVYPSLDSSIGSPSHS 358
            :..|...         |..|||.|.:        :.|.||..||::
  Fly   324 QQLDAKALILIGSEQNGEALGSPNPW--------AADPSIAPPSYA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 37/145 (26%)
Arrestin_C 178..305 CDD:280848 32/126 (25%)
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 37/146 (25%)
Arrestin_C 174..306 CDD:214976 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464098
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.