DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ARRDC3

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_065852.1 Gene:ARRDC3 / 57561 HGNCID:29263 Length:414 Species:Homo sapiens


Alignment Length:403 Identity:94/403 - (23%)
Similarity:162/403 - (40%) Gaps:69/403 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSK- 74
            ||...||.:||.:.|.:.:.|....:::::|:...|..|.:|.| .|...:|..|:::  ||.: 
Human    18 DSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTE-SRNAGSNTAYTQN--YTEEV 79

  Fly    75 EVYEHSETPL-----PDFEPRGLE-LSAGEHTFIFEVALGR-QLPSSFKGSYGAIKYKMRVLIQR 132
            |.:.|.:..:     .|....|.. :.:|.|.:.|...|.: .|.:||:|.:|:::|.::..:.|
Human    80 EYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHR 144

  Fly   133 PWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEPLR 197
            ||....:....|||.:::.:.......|.:..|:.|.......:.||:|.|.:.......||.::
Human   145 PWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQ 209

  Fly   198 ICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLP 262
            |.|.:.|.|:..|.. :..:.|...:|:...::..| :.:|....|:.| ..|||......|.:|
Human   210 IFAEIENCSSRMVVP-KAAIYQTQAFYAKGKMKEVK-QLVANLRGESLS-SGKTETWNGKLLKIP 271

  Fly   263 DGAQPTDEQM--SGVITIVYELRVEAVLRGFFKNLILNLPFKV--------------YSQDPSNR 311
                |....:  ..:|.:.|.|.|...:.|.. :|.||||..:              .|...|..
Human   272 ----PVSPSILDCSIIRVEYSLMVYVDIPGAM-DLFLNLPLVIGTIPLHPFGSRTSSVSSQCSMN 331

  Fly   312 QSSLRPPPPPRPNDGPPG------PELGSGNL--------FEPAL----------------PVYP 346
            .:.|....|.|| :.||.      .|....||        ||.||                |:|.
Human   332 MNWLSLSLPERP-EAPPSYAEVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYS 395

  Fly   347 SLDSSIGSPSHSS 359
            .:|.   :|..|:
Human   396 EIDP---NPDQSA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 38/148 (26%)
Arrestin_C 178..305 CDD:280848 33/142 (23%)
ARRDC3NP_065852.1 Arrestin_N 22..165 CDD:334019 36/145 (25%)
Arrestin_C 187..314 CDD:214976 33/134 (25%)
PPxY motif 1. /evidence=ECO:0000305 346..349 2/2 (100%)
PPxY motif 2. /evidence=ECO:0000305 391..394 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.