DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc3a

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001073498.1 Gene:arrdc3a / 566685 ZFINID:ZDB-GENE-030131-2913 Length:414 Species:Danio rerio


Alignment Length:390 Identity:95/390 - (24%)
Similarity:161/390 - (41%) Gaps:64/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSK- 74
            ||...|:.:||.:.|.:.:.|....:::::|:...|..|.:|.| .|...::..|:::  ||.: 
Zfish    18 DSNVPVFSSGDSVSGRVIIEVTGEIRVKSLKINAKGFAKVRWTE-SRNAGSSTAYTQN--YTEEV 79

  Fly    75 EVYEHSETPL-----PDFEPRGL-ELSAGEHTFIFEVALGR-QLPSSFKGSYGAIKYKMRVLIQR 132
            |...|.:..:     .|....|| .:.:|.|.:.|...|.: .|.:||:|.:|:::|.::..:.|
Zfish    80 EYLNHRDILIGHERDDDNSEEGLTTIHSGRHEYAFSFELPQTPLATSFEGKHGSVRYWVKAELHR 144

  Fly   133 PWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEPLR 197
            ||....:....|||.:::.:.......|.:..|:.|.......:.||:|.|.:.......||.::
Zfish   145 PWLLPMKTKKEFTVFEHIDINTPLLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQ 209

  Fly   198 ICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLP 262
            |.|.:.|.|:..|.. :..:.|..|:::...::..| :.:|....|:.| ..|||......|.:|
Zfish   210 IFAEIENCSSRMVVP-KAAIYQTQTFFAKGKMKEIK-QLVANIRGESLS-SGKTETWNGKMLKIP 271

  Fly   263 DGAQPTDEQM--SGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDP----SNRQSSL------ 315
                |....:  ..:|.:.|.|.|...:.|.. ||.||||. |....|    .:|.||:      
Zfish   272 ----PVSPSILDCSIIRVEYSLMVYVDIPGAM-NLSLNLPL-VIGTIPLHPFGSRTSSVSSQCSM 330

  Fly   316 -----------RPPPPP----------RPN--DGPPGPELGSGNL--------FEPALPVYPSLD 349
                       ||..||          |.|  :..||.|...|.|        |.|. |.|..:|
Zfish   331 TMSWLGMALPERPEAPPAYAEVVTEEQRQNCLEVSPGRENYDGPLFAYIQEFRFRPP-PPYSEID 394

  Fly   350  349
            Zfish   395  394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 37/148 (25%)
Arrestin_C 178..305 CDD:280848 35/128 (27%)
arrdc3aNP_001073498.1 Arrestin_N 22..165 CDD:278754 35/145 (24%)
Arrestin_C 188..311 CDD:280848 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.