DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and Txnip

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:383 Identity:82/383 - (21%)
Similarity:154/383 - (40%) Gaps:66/383 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYT 72
            :..:..::||.:|:.:.|.:.:.|.:.|:::|:::...|..|..||:..::.....:|.|     
Mouse    12 VVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLR----- 71

  Fly    73 SKEVYEHSETPLPDFEPRGLELSAGEHTFI-------FEVALGRQLP-----SSFKGSYGAIKYK 125
                ||  :|.|.:.:|     :|||:..:       :|...|.:||     :||||.||.:.|.
Mouse    72 ----YE--DTLLLEEQP-----TAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYW 125

  Fly   126 MRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFA 190
            ::..:.||....:.....|.|:..:.:.......|.|.:|:...:........:::.|.:.....
Mouse   126 VKAFLDRPSQPTQEAKKNFEVMDLVDVN
TPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGF 190

  Fly   191 VRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRV--QKVECIAVATKETGSVQKKTER 253
            ..|:.:.|.|...|..:..|......|.:: ||.::...:|  ||:..:......:|:......:
Mouse   191 CEGDDISIHADFENTCSRIVVPKAAIVARH-TYLANGQTKVFTQKLSSVRGNHIISGTCASWRGK 254

  Fly   254 SFAHELLLPD--GAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDP-SNRQSS- 314
            |...:.:.|.  |.        .::.:.|.|.:...:.| .|.:||:||..:.|:.. |:|.|| 
Mouse   255 SLRVQKIRPSILGC--------NILKVEYSLLIYVSVPG-SKKVILDLPLVIGSRSGLSSRTSSM 310

  Fly   315 ------------LRPPPPPRPNDGPPG-----PELGSGNLFEPALPVYPSLDSSIGSP 355
                        |..|..|   :.||.     ||  ...|..|..|:...:|.|..||
Mouse   311 ASRTSSEMSWIDLNIPDTP---EAPPCYMDIIPE--DHRLESPTTPLLDDVDDSQDSP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 36/155 (23%)
Arrestin_C 178..305 CDD:280848 24/130 (18%)
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:304627 36/156 (23%)
Arrestin_C 175..299 CDD:280848 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.