DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and zgc:110626

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001017889.1 Gene:zgc:110626 / 550588 ZFINID:ZDB-GENE-050417-447 Length:454 Species:Danio rerio


Alignment Length:483 Identity:112/483 - (23%)
Similarity:186/483 - (38%) Gaps:93/483 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYS-RSLFYT----- 72
            :..:.:||.|.|::.:.|.|.|:::::.|::.||....|.|  |.......|| :..||:     
Zfish    18 NNTFTSGDYISGKVILEVVKDTQMQSLSVKIKGKANVCWSE--RHGKTTVLYSDKEKFYSVERFF 80

  Fly    73 ----SKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQ-LPSSFKGSYGAIKYKMRVLIQR 132
                :|...:|.....|..:|....::.|.|.:.|...|..| .||::|||.|.:.|.:...:.|
Zfish    81 VQTDTKHANDHEMLKDPSGQPYSSVVAPGRHVYPFTFQLPLQHFPSTYKGSVGKVLYTLETKLSR 145

  Fly   133 PWTFD-----ERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVR 192
            .....     |.:.:|..||.|..|...|.   .:.:||::     |.|.....:.:..|..|..
Zfish   146 SMRVSSKAKAEF
NYVPCPVVTNPELMAPQY---GTKDKQMS-----FFTSGSVSMNISTEKMAYH 202

  Fly   193 -GEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGS-VQKKTERSF 255
             ||.|:..|.|.|||:.|| |.::.:.:..::::....::...:..    ||.|. ::..::::.
Zfish   203 LGEGLKFLAEVQNNSSRAV-KPKYCLYEKHSFFARGKRKLHTHDIF----KEMGEPIEPSSKKTI 262

  Fly   256 AHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGF------FKNLIL------------NLPFK 302
            ...|.:|.....:..... ::.:.|.|||...::..      |..:||            |..|.
Zfish   263 TTVLTIPPSLTVSILNCR-ILKVEYRLRVYLDVKYASDPEIKFPIVILPVQPVSGANGARNNDFG 326

  Fly   303 VYSQDPSNRQSSLRPPPPP-----RPND--GPPGPELGSGNLFEPA----LPVYPSLDSSIGSPS 356
            :::|.|.....   |.|||     :|::  ||||.....||...|.    .|.||......|.|.
Zfish   327 IWNQPPPGIAG---PNPPPTAPSAQPHNMAGPPGQFSAPGNYGPPVGQFPSPGYPGPPLGQGGPP 388

  Fly   357 HSSQFSECSSINSITSDSSAATLSPAVGAGTGGMDMSYTSGSQSSQYGSPSARTSLRSSNVPYMP 421
                        |.|........:||.....|....||.||: ..|:||.....|..|:..||..
Zfish   389 ------------SYTGPPLGQFGAPAFPGPPGQSAPSYYSGA-PGQFGSSVPLQSSTSAPPPYQE 440

  Fly   422 YSSSPLMVQSYPPPHLPAYPPPESPQYS 449
            |...|.:              |:.|:.|
Zfish   441 YKFYPQL--------------PDQPEKS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 39/153 (25%)
Arrestin_C 178..305 CDD:280848 27/146 (18%)
zgc:110626NP_001017889.1 Arrestin_N 16..157 CDD:304627 34/140 (24%)
Arrestin_C 187..309 CDD:280848 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579441
Domainoid 1 1.000 65 1.000 Domainoid score I10015
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.