DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc3

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001016843.1 Gene:arrdc3 / 549597 XenbaseID:XB-GENE-5732341 Length:412 Species:Xenopus tropicalis


Alignment Length:406 Identity:97/406 - (23%)
Similarity:165/406 - (40%) Gaps:72/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSK-EVYEH 79
            ||.:||.:.|.:.:.|....:::::::...|..|.:|.| .|...:|..|:::  ||.: |.:.|
 Frog    23 VYSSGDAVSGRVNLEVTGEIRVKSLRIHARGHAKVRWTE-SRNAGSNTAYTQN--YTEEVEYFSH 84

  Fly    80 SETPL-----PDFEPRGL-ELSAGEHTFIFEVALGRQLP--SSFKGSYGAIKYKMRVLIQRPWTF 136
            .:..:     .|....|| .:.:|.|.:.|...| .|:|  :||:|.:|:::|.::..:.|||..
 Frog    85 KDILIGHERDDDNSEEGLTTIHSGRHEYAFSFEL-PQIPLATSFEGRHGSVRYWVKAELHRPWLL 148

  Fly   137 DERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEPLRICAT 201
            ..:....|||.:::.:.......|.:..|:.|....|..:.||:|.|.:.......||.::|.|.
 Frog   149 PVKLKKEFTVFEHIDIN
TPSLLAPQAGTKEKTLCCWLCTSGPISLSAKIERKGYTPGESIQIFAE 213

  Fly   202 VINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLPDGAQ 266
            :.|.|:..|.. :..:.|..|:|:...::..| :.:|....|:.| ..|||......|.:|    
 Frog   214 IENCSSRMVVP-KAALYQTQTFYAKGKMKEVK-QLVANLRGESLS-SGKTETWNGKLLKIP---- 271

  Fly   267 PTDEQM--SGVITIVYELRVEAVLRGFFKNLILNLPF---------------KVYSQDPSNRQSS 314
            |....:  ..:|.:.|.|.|...:.|.. :|.||||.               .|.||...|....
 Frog   272 PISPSIIDCSIIRVEYSLMVYVDIPGAM-DLFLNLPLVIGTIPLHPFGSRTSSVSSQYSINNWLG 335

  Fly   315 LRPPPPPRPNDGPPG----------PELGSGNL---FEPAL----------------PVYPSLDS 350
            |..|..|   :.||.          ..|.|.|.   ||.||                |:|..:|.
 Frog   336 LTLPERP---EAPPSYAEVVTEEQRQNLMSSNACDNFELALQGPLFAYIQEFRFLPPPLYSEVDP 397

  Fly   351 SIGSPSHSSQFSECSS 366
            :...|  :.:...|.|
 Frog   398 NPDQP--TEEHPSCPS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 37/144 (26%)
Arrestin_C 178..305 CDD:280848 35/143 (24%)
arrdc3NP_001016843.1 Arrestin_N 9..165 CDD:334019 37/145 (26%)
Arrestin_C 187..314 CDD:214976 34/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.