DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and txnipb

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001239433.1 Gene:txnipb / 448858 ZFINID:ZDB-GENE-040917-1 Length:378 Species:Danio rerio


Alignment Length:461 Identity:96/461 - (20%)
Similarity:159/461 - (34%) Gaps:145/461 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEV----Y 77
            |..||.:.|.:.:.|.:..|:.|:|:...|..|.             .|.:...:.|:|:    |
Zfish    23 YSGGDKVAGRVIVEVAELLKVSAVKLFGVGCAKV-------------NYKKGKLHCSEEIEYLKY 74

  Fly    78 E-------HSETPLPDFEPRGLELSAG---EHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQR 132
            |       ||.|.    :...:.|..|   |..|.||:.....|.||::|.:|:::|.:|.::::
Zfish    75 EEILHLDHHSTTD----DEGSITLRPGNRYEFMFGFELPQSGCLVSSYEGKFGSVQYYVRAVMEK 135

  Fly   133 -PWTFDE--RHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGE 194
             ..||.|  |:   |.||:.:.:...:...|....||...|........::::|.:.......||
Zfish   136 SSQTFAECKRY---FEVVEPIDVN
TQELMAPVKGSKQKKVTCMFIPDGSVSIVASIGRKGYCEGE 197

  Fly   195 PLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHEL 259
            .:.|.|...|.|:..|                :|......:.|.:|...|...::|......:.:
Zfish   198 DICIDAQFENTSSRIV----------------IPKAAIIAKHIYLANGRTKVFEEKLTSVRGNHI 246

  Fly   260 LLPDG------------AQPTDEQMSG--VITIVYELRVEAVLRGFFKNLILNLPFKVYSQDPSN 310
            :...|            .:||   :.|  :|.:.|.||:...:.|..| |||.||.         
Zfish   247 ISGMGDIWQGRVLRVPKLKPT---ILGCDIIHVDYSLRIYLHIPGSEK-LILELPL--------- 298

  Fly   311 RQSSLRPPPPPRPNDGPPGPELGSGNLFEPALPVYPSLDSSIGSPSHSSQFSECSSINSITSDSS 375
                                                    .||:..::...|..||::|..|.||
Zfish   299 ----------------------------------------VIGTIPYNGMNSRTSSMSSQESASS 323

  Fly   376 AATLSPAVGAGTGGMDMSYTSGSQSSQYGSPSARTSLRSSNVPYM---PYSSSPLMVQSYPPPHL 437
            .....|                |....|.:.|.|  :.||.:|.:   ....||:.:|.:.|  |
Zfish   324 TCVSLP----------------SSPPSYSNISNR--MDSSFIPLLDDYDEDDSPIFMQIHHP--L 368

  Fly   438 PAYPPP 443
            |  |||
Zfish   369 P--PPP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 38/151 (25%)
Arrestin_C 178..305 CDD:280848 28/140 (20%)
txnipbNP_001239433.1 Arrestin_N 11..156 CDD:304627 38/152 (25%)
Arrestin_C 179..305 CDD:214976 30/194 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.