DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc3b

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001004605.1 Gene:arrdc3b / 447866 ZFINID:ZDB-GENE-040912-182 Length:412 Species:Danio rerio


Alignment Length:392 Identity:90/392 - (22%)
Similarity:155/392 - (39%) Gaps:70/392 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKE 75
            ||...|:.:||.:.|.:.:.|....::|::.:...|..|.:|.| .|...:|..|:|. |....|
Zfish    18 DSNVPVFASGDFVSGRVIVEVTGEIRVRSLNIHAKGLAKVRWTE-SRSAGSNTAYTRH-FTEEVE 80

  Fly    76 VYEHSET-PLPDFEPRGLE-----LSAGEHTFIFEVALGR-QLPSSFKGSYGAIKYKMRVLIQRP 133
            ...|.:. .|.|.:....:     |.:|.|.|.|.:.|.: .|.:||:|.:|:::|.::..:.|.
Zfish    81 YLNHRDVLILHDRDDDCCDEAFTVLHSGRHEFPFSLELPQTPLATSFEGKHGSVRYWVKAELHRQ 145

  Fly   134 WTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEPLRI 198
            |....:....|||.:::.:.......|.:..|..|.......:.|::|.|.:.......||.::|
Zfish   146 WLLPMKTKKEFTVFEHIDINTPLLLSPQAGTKDKTLCCWFCTSGPVSLSAKIERKGYTPGETIQI 210

  Fly   199 CATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLPD 263
            .|.:.|.|:..|.. :..:.|..|:::..  :|::::.:....:.......|||......|.:| 
Zfish   211 FAEIENCSSRVVVP-KAALYQTQTFFAKG--KVKEIKQLIANLRGDPLHSGKTETWDGKMLKIP- 271

  Fly   264 GAQPTDEQM--SGVITIVYELRV-----EAVLRGFFKNLILNLPFKVYSQDP----SNRQSSL-- 315
               |....:  ..:|.:.|.|.|     .||      ||.||||. |....|    .:|.||:  
Zfish   272 ---PISPSILDCSIIHVEYSLMVYVDIPRAV------NLTLNLPL-VIGTIPLHSFGSRTSSVSS 326

  Fly   316 -------------RPPPPPR------------PNDGPPGPELGSGNL--------FEPALPVYPS 347
                         ||..||.            .:|.|...:...|.|        |:|. |:|..
Zfish   327 QCSMAMSWLGLPERPEAPPSYSEIITDEERQCSSDLPAVRDEIEGPLYAYIHEFRFQPP-PLYSE 390

  Fly   348 LD 349
            :|
Zfish   391 VD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 38/147 (26%)
Arrestin_C 178..305 CDD:280848 32/133 (24%)
arrdc3bNP_001004605.1 Arrestin_N 22..165 CDD:278754 36/144 (25%)
Arrestin_C 188..311 CDD:280848 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.