DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG2993

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001262348.1 Gene:CG2993 / 40924 FlyBaseID:FBgn0037521 Length:545 Species:Drosophila melanogaster


Alignment Length:470 Identity:106/470 - (22%)
Similarity:186/470 - (39%) Gaps:84/470 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSL-----FYTSKE 75
            ||:||..:.|.:.::|:...:|:.|.|.|:|..|.:|:    |.....:..|::     .|.|..
  Fly    16 VYYAGQELSGVVDLSVDATKRIKGIHVTVSGYAKIRWI----KKGYPRDSERAMCRAYRSYLSSR 76

  Fly    76 VY------EHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPW 134
            .|      .:|....|          |||:::.|.|.|...||:||.|.||.|.|::...|:|..
  Fly    77 SYVLGSCANNSSIDWP----------AGEYSYTFHVILPDNLPTSFDGKYGQIHYEIITTIERAA 131

  Fly   135 TFDERHTIPFTVVK----------NMPLQPMQRSIPSSLEKQVTKTISLF--GTRPITLLALLPE 187
            ...:...:||||::          .:||:.:.|           |....|  .|.|:|:....|.
  Fly   132 RHPKVFKLPFTVIQPLDLN
ADAIYRVPLEILDR-----------KRFWSFCCPTGPLTVKFSTPY 185

  Fly   188 DFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTE 252
            .....|:.:.....:.|.|:..:.:....:.|.|:|.||.|....:.:...:|.|:.|:|.:.:.
  Fly   186 CGYAPGQKIHFVLYINNESSIDIIECEVKLKQEVSYESHDPQHEYRYDKHLIARKQFGNVLRWSR 250

  Fly   253 RSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYS----QDPS---- 309
            :.:...|.|| ...||..:.:..|::.|.:::......|...|.|.:|..:.|    ..|.    
  Fly   251 KVYRGYLDLP-SIPPTSVKPTCPISVNYSIKIIVNPTEFHWKLKLKIPLTIGSIPIMDGPEALLR 314

  Fly   310 -NRQ--------SSLRPPPPPRPNDGPPGPELGSGNLFEPALPVYPSLDSSIGSPSHSSQFSECS 365
             |||        .:|:.....|..|.....::.        :......|......|.|.|....|
  Fly   315 FNRQQQQHQVVSQNLQMSTQQRQRDRDRDRDMN--------VDRERDRDRDRDRISASVQQRRIS 371

  Fly   366 SINSITSDSSAATLSPAVGAGTGGMDMSYTSGSQSSQYGSPSA---RTSLRSSNVPYMPYSSSPL 427
            |||:  ::::...|...:......|:| .|:.|.:....:||:   ..:||.:.:|.:..:|.  
  Fly   372 SINN--NNNNHGRLVGGLLPTNSNMNM-ITNVSPTPTSSTPSSTPTTAALRPTAMPAILVTSD-- 431

  Fly   428 MVQSYPPPHLPAYPP 442
              ...||.::|..||
  Fly   432 --SDNPPDYIPMMPP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 41/156 (26%)
Arrestin_C 178..305 CDD:280848 27/126 (21%)
CG2993NP_001262348.1 Arrestin_N 5..150 CDD:304627 41/147 (28%)
Arrestin_C 173..302 CDD:280848 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.