DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG18268

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster


Alignment Length:311 Identity:66/311 - (21%)
Similarity:121/311 - (38%) Gaps:66/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LDSADRVYFAGDIIRGEIWMNVN--KRTKIRAIKVQVTGKGKCKWMEILR-------KNSNNNEY 65
            |..|..:|:.|:.|.|.:.:.|:  |..|:..:.|.:.|.....|.|.||       .:|..|..
  Fly     9 LSRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEHNDSTGNLE 73

  Fly    66 SRSLFYTSKEVYEHSETPLPDFEPRGLELSAGEHTF---IFEVALGRQLPSSFKGSYGAIKYKMR 127
            ...:.|...:|:.:....|.:.    |:|..|  ||   .|...|...||::.:..:|.::|.::
  Fly    74 CPKVDYNGSKVHINETKKLNEV----LQLENG--TFRLGDFNFQLPENLPATCRLPFGNVEYVLK 132

  Fly   128 VLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVR 192
            |:::|..|.::.......:.|.:.|        :.|:.|..:|.::..|        ||....|.
  Fly   133 VVLERRGTHNKCFQQRLVIRK
CVEL--------ADLKPQYMETANMGLT--------LPRSVFVP 181

  Fly   193 GEPL--RICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQK--VECIAVATKETGSVQ-KKTE 252
            |:.:  .||      |...|:.....:.:.::|.|..|....|  .:.::.:::..|::: ..|.
  Fly   182 GQSVSYEIC------SKDGVQDFLTRLCKKISYTSQQPSAKTKNVTQVLSESSELNGNLRLPLTA 240

  Fly   253 RSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKV 303
            ...:|.    |...|        |.|.|.:..       |.:  ||.|.||
  Fly   241 PIMSHS----DQLDP--------IQISYYIET-------FNS--LNAPIKV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 35/153 (23%)
Arrestin_C 178..305 CDD:280848 26/131 (20%)
CG18268NP_649739.1 Arrestin_N 5..153 CDD:304627 34/149 (23%)
Arrestin_C 172..259 CDD:280848 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.