DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG10086

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster


Alignment Length:480 Identity:122/480 - (25%)
Similarity:198/480 - (41%) Gaps:78/480 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SERLRITLDSADR-VYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSN----N 62
            |:...||.|..:. .||.|.:|.|::.:|:||..|:|.||:|::|..:.:|.  :|::..    .
  Fly     2 SKNCMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWR--IRRHGKAVAIQ 64

  Fly    63 NEYSRSLF-YTSKEVYEHSETPLPDFEP-RGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYK 125
            |...||.. |:.:|.|..|.|.|...|. ....:.||.:|:.|...:....||||:|:||.|:|.
  Fly    65 NPKKRSKHQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYL 129

  Fly   126 MRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFA 190
            .:|...:|...:..|.:.|||:|.:.|....:.:......:..:...|..|:|:.|...|.:...
  Fly   130 AKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQQQGY 194

  Fly   191 VRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSF 255
            |.|:.:.|.|.|.|:|::...||...:....||.:..|......|.|.:..:|.|.|....:|::
  Fly   195 VPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECGPVAHNAQRTY 259

  Fly   256 AHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDPSNRQSSLRPPPP 320
            ...|.:|..| ||.|.:|.|:.:.||:||.||:.....|..|.:|..:.:...:...|       
  Fly   260 TETLRIPATA-PTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVS------- 316

  Fly   321 PRPNDGPPGPELGSGNLFEPALPVYPSLDSSIGSPSHSSQFSE--CSSINSITSDSSAATLSPAV 383
                    ||:....|.|                ||.||..::  |:|..::.....||:     
  Fly   317 --------GPDFLPTNAF----------------PSGSSLPADLPCTSTRAMELAQMAAS----- 352

  Fly   384 GAGTGGMDMSYTSGSQSSQYGSP-SARTSLRSSN--VPYMP---YSSSPLMV------------- 429
            |....|.:|:    .....:..| .....|.:::  ||.:|   |..:..|.             
  Fly   353 GVSNSGYEMA----EDLEDFELPEDGDDELEAADDFVPDLPPPTYEQAMFMTTDIADTDANTVSE 413

  Fly   430 QSYPPPHLPAY-------PPPESPQ 447
            .|...|..|.:       |||..||
  Fly   414 ASRFTPRYPVFDVDTFQSPPPNPPQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 49/152 (32%)
Arrestin_C 178..305 CDD:280848 38/126 (30%)
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 49/153 (32%)
Arrestin_C 179..308 CDD:280848 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464097
Domainoid 1 1.000 65 1.000 Domainoid score I10015
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.