DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and CG1105

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649688.1 Gene:CG1105 / 40841 FlyBaseID:FBgn0037465 Length:422 Species:Drosophila melanogaster


Alignment Length:397 Identity:103/397 - (25%)
Similarity:176/397 - (44%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILR------KNSN----- 61
            :.||:....|:||..:.|::....:...|:|.|.::..|:...:|.|...      |..|     
  Fly     8 LQLDNPWNTYYAGQTVNGQVKFTFDSPKKVRGIIIRFLGEANTEWSEEKSVTTSEGKTENEVTQL 72

  Fly    62 --NNEYSRSLFYT--SKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAI 122
              :.||.:..:|.  .|   ..|||.||          .|.||:.|..||...|||||:|.:|.:
  Fly    73 KGHEEYFKIQYYLLGGK---NSSETELP----------PGTHTYPFTCALPPNLPSSFEGEFGHV 124

  Fly   123 KYKMRVLIQRPWTFDERHTIPFTVVK--NMPLQPMQRSIPSSLEKQVTKTISLFGTR--PITLLA 183
            :|.::|.:.|||.||:...:.|||:.  ::.|.|..:. |..||  :.|:...|..|  |:.::.
  Fly   125 RYTIKVTLDRPWKFDQDMKMAFTVIAPVDLN
LNPRVKE-PFKLE--LEKSFCCFCCRSGPLAVIT 186

  Fly   184 LLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQ 248
            .:|:...|.|:.|.|...|.|.|...:..::|.:.:.||::::.|...::...:.:|....|.|.
  Fly   187 NIPQTGFVSGQVLPITCEVDNTSNVNLTAVKFELRKLVTFHTNQPRSEKRESKVIIANLSVGPVN 251

  Fly   249 KKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKV---------- 303
            ....|:|..::.:| ...||:....|:|.:.|:|.||..:.|..:||...:|..:          
  Fly   252 GGESRTFTQQMEIP-ALPPTNLLNCGIIALDYDLHVECEVSGPHRNLTGKVPITLGTIPLAGVRP 315

  Fly   304 ---YSQDPSNRQS---SLRPPPPPRPNDGPPGPE-------------LGSGNLFEPALPVYPSLD 349
               ::..||..||   ||.|..|..| ..|||.:             .|.|:|: |.:|....::
  Fly   316 PTQFTDAPSAVQSEDPSLAPTQPVSP-ASPPGGDGVGGALGWNVADSTGGGSLY-PNIPPPQFVE 378

  Fly   350 SSIGSPS 356
            :...:|:
  Fly   379 TQYRAPT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 46/160 (29%)
Arrestin_C 178..305 CDD:280848 31/139 (22%)
CG1105NP_649688.1 Arrestin_N 6..155 CDD:278754 46/159 (29%)
Arrestin_C 178..307 CDD:280848 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.