DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and Arrdc4

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001380690.1 Gene:Arrdc4 / 293019 RGDID:1311763 Length:415 Species:Rattus norvegicus


Alignment Length:381 Identity:89/381 - (23%)
Similarity:145/381 - (38%) Gaps:57/381 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLF----- 70
            |.:...|.:|:.:.|.:.:...:...:|.::::..|:....|        ..:..:|...     
  Rat    23 DESKGCYSSGETVAGHVLLEAAEPVTLRGLRLEAQGRATSAW--------GPSAGARVCIGGASP 79

  Fly    71 YTSKEVYEHSETPLPDFE-PRG---LELSAGEHTFIFEVALGRQLPS-----SFKGSYGAIKYKM 126
            ..|.|| |:....|...| |.|   ..|..|:|.|.|..    ||||     ||.|.||:|:|.:
  Rat    80 AASSEV-EYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRF----QLPSEPLATSFTGKYGSIQYCV 139

  Fly   127 RVLIQRPWTFDERHTIPFTVVKNMPLQ--PMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDF 189
            |.:::||...|:.......||.::.:.  |:...:..:.||.|  ...||.:.|::|...:....
  Rat   140 RAVLERPQVPDQSVRRELQVVSHVDVN
TPPLLTPMLKTQEKMV--GCWLFTSGPVSLSVKIERKG 202

  Fly   190 AVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERS 254
            ...||.:.|.|.:.|.|:..|.. :..:.|..||.:....:..:.....|.....||  ..|:..
  Rat   203 YCNGEAIPIYAEIENCSSRLVVP-KAAIFQTQTYLASGKTKTVRHMVANVRGNHIGS--GSTDTW 264

  Fly   255 FAHELLLPDGAQPTDEQMSG--VITIVYELRVEAVLRGFFKNLILNLPFKV----YSQDPSNRQS 313
            ....|.:|    |....:..  :|.:.|.|.|...:.| .|.|:|.||..:    || ....|.|
  Rat   265 NGKMLKIP----PVTPSILDCCIIRVDYSLAVYIHIPG-AKKLMLELPLVIGTIPYS-GFGRRNS 323

  Fly   314 S-----------LRPPPPPRPNDGPPGPELGSGNLFEPALPVYPSLDSSIGSPSHS 358
            |           |....|.:|...|...::.|...|...:|.||...:..|...:|
  Rat   324 SMASQFSMDMCWLALALPEQPEAPPNYADVVSEEEFSRHIPPYPQPSACDGEACYS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 38/154 (25%)
Arrestin_C 178..305 CDD:280848 29/132 (22%)
Arrdc4NP_001380690.1 Arrestin_N 19..166 CDD:395268 38/155 (25%)
Arrestin_C 188..315 CDD:214976 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.