DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ZK938.11

DIOPT Version :10

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:71 Identity:23/71 - (32%)
Similarity:37/71 - (52%) Gaps:17/71 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YSRS-LFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRV 128
            :.|| :.:|||:    .:..||      :||.  |.:|.|::..|.:|  ::|.  |.|||.|.:
 Worm    14 FKRSAIVWTSKD----GKNKLP------VELL--EKSFEFQIPTGSRL--TYKA--GHIKYTMSL 62

  Fly   129 LIQRPW 134
            .:.|||
 Worm    63 EVDRPW 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:451447 23/71 (32%)
Arrestin_C 191..308 CDD:214976
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.