powered by:
Protein Alignment Leash and ZK938.11
DIOPT Version :9
Sequence 1: | NP_650037.2 |
Gene: | Leash / 41320 |
FlyBaseID: | FBgn0037856 |
Length: | 520 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001317870.1 |
Gene: | ZK938.11 / 28661663 |
WormBaseID: | WBGene00270290 |
Length: | 129 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 37/71 - (52%) |
Gaps: | 17/71 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 YSRS-LFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRV 128
:.|| :.:|||: .:..|| :||. |.:|.|::..|.:| ::|. |.|||.|.:
Worm 14 FKRSAIVWTSKD----GKNKLP------VELL--EKSFEFQIPTGSRL--TYKA--GHIKYTMSL 62
Fly 129 LIQRPW 134
.:.|||
Worm 63 EVDRPW 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D311636at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000089 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.