DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ZK938.11

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:71 Identity:23/71 - (32%)
Similarity:37/71 - (52%) Gaps:17/71 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YSRS-LFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRV 128
            :.|| :.:|||:    .:..||      :||.  |.:|.|::..|.:|  ::|.  |.|||.|.:
 Worm    14 FKRSAIVWTSKD----GKNKLP------VELL--EKSFEFQIPTGSRL--TYKA--GHIKYTMSL 62

  Fly   129 LIQRPW 134
            .:.|||
 Worm    63 EVDRPW 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 23/71 (32%)
Arrestin_C 178..305 CDD:280848
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:389964 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.