DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and SPBC18H10.20c

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_595744.1 Gene:SPBC18H10.20c / 2540833 PomBaseID:SPBC18H10.20c Length:361 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:50/231 - (21%)
Similarity:71/231 - (30%) Gaps:73/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LILNLPFKVYSQDPSNRQSSLRPPPPPRPNDGPPGPELGSGN----------LFEPALPV----- 344
            |.|.||.....:||:.....:|...||....|  .||..||.          |.:|.:.|     
pombe     3 LKLALPRSTTPKDPARCTLDIRMESPPLVFLG--SPETSSGALASGILKLTILHQPFIKVHTLKL 65

  Fly   345 ---------YPSLDSSIGSPSHSSQFSECSSINSI--TSDSSA-ATLSPAVGAGTGGMDMSY--- 394
                     :|::          |..|.|:....:  |.|.:| .|..|    ||.....|:   
pombe    66 QLIKRITVLHPAI----------SHCSACAGSKEVLQTWDLAANTTYRP----GTQHWPFSWLFP 116

  Fly   395 --TSGSQSSQ-------------YGSPSARTSLRSSNVPYMPYSSSPLMVQSYPPPHLPAYPPPE 444
              ...|.|::             ||:|....|.....|...|.......:.|....|...:||. 
pombe   117 GSLPASVSNRYIKLEYYLEATLCYGTPEGGISPSKPEVLKFPLQLKRAAIPSPDTIHKRIFPPT- 180

  Fly   445 SPQYSLLA-------LTPPPAGVVAAPPTGGAAAGG 473
                :|:|       |.|..|.::....||.|...|
pombe   181 ----NLVANITLPSTLHPHGAALMEVTMTGFAQNDG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627
Arrestin_C 178..305 CDD:280848 4/9 (44%)
SPBC18H10.20cNP_595744.1 LDB19 63..242 CDD:193475 33/169 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.