DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-5

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_496119.1 Gene:arrd-5 / 191469 WormBaseID:WBGene00014161 Length:378 Species:Caenorhabditis elegans


Alignment Length:335 Identity:83/335 - (24%)
Similarity:145/335 - (43%) Gaps:43/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VYFAGDIIRGEIWMNV-NKRTKIRAIKVQVTGKGKCKWMEILRKNS---NNNEYSR----SLFYT 72
            |:..|:.:.|.:.|.: :...|.|.:::::.||....|...:|.|.   .|.:.:|    ...:.
 Worm    14 VFSPGEKVTGNVKMTIPDDEFKARKVRMEMIGKAYTYWEGNVRNNHTKIKNGDIARVRHNCADHK 78

  Fly    73 SKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPWTFD 137
            .|.||...||.:...:....::.:|.|.|.|...|....|.||:|..|.|:|.::|.|.|||.||
 Worm    79 GKIVYCRFETIVWKSDGAKNDMPSGPHIFPFSFQLPHWAPPSFEGDLGFIRYFIKVEIDRPWKFD 143

  Fly   138 ERHTIPFTVVKNMPLQPMQRS-IPSSLEKQVTKTIS--LFGTRPITLLALLPEDFAVRGEPLRIC 199
            ::.....||:.|:.|:.:..| :||  :|.|.:...  |:....:.:...||:...|.||.:.:.
 Worm   144 DKFITCLTVLPNIDL
RLIPNSQVPS--KKHVCEEFGAVLWKNGLVRMELRLPKQGFVCGENIPVT 206

  Fly   200 ATVINNSTTAVEKLRFTVLQYVTY--------YSH-VPLRVQKVECIAVATK------------- 242
            ..|.|.::.:.:|:...::|.|||        .|| .|....:.|.|..||:             
 Worm   207 MIVDNKTSKSFKKISLRLVQRVTYTGFRDGFVNSHSQPCIGNEKEKITYATRLNAQTRVEERQIS 271

  Fly   243 ETG---SVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLI-LNLPFKV 303
            ||.   .:.|..::.....:.||  ..|...:...:|.:.|.|:|:....|..|:.: |.|.|.:
 Worm   272 ETNIDIKIDKNEKQEVEKPIPLP--PLPPSTKTCEIIDVEYFLKVKMSTSGALKSAVKLELAFII 334

  Fly   304 YSQ--DPSNR 311
            .:.  ||..:
 Worm   335 GTMPIDPERK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 40/143 (28%)
Arrestin_C 178..305 CDD:280848 34/152 (22%)
arrd-5NP_496119.1 Arrestin_N 4..158 CDD:334019 40/143 (28%)
Arrestin_C 182..338 CDD:214976 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.