DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-12

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001309576.1 Gene:arrd-12 / 187636 WormBaseID:WBGene00011053 Length:186 Species:Caenorhabditis elegans


Alignment Length:156 Identity:41/156 - (26%)
Similarity:68/156 - (43%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKW--MEILRKNSNNNE---YSR 67
            :..|..:.||.||..|.|.:..:...:...|.|.||:.|:....:  .|...|.::..|   .:.
 Worm     6 VLFDKPNAVYAAGQKISGRVVFSTASQQNPRWIDVQLHGRSHTFFTRQESETKTNSKGESETKTH 70

  Fly    68 SLFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALG-RQLPSSFKGSYGAIKYKMRVLIQ 131
            ::.||:...:..:..||.....:...|..|::.:.|...|. ..||.||:|:.|.|:|.:|..:.
 Worm    71 TVHYTATAKHLDTAVPLWRKTDKAARLLPGKYEWQFWFQLPCSVLPPSFEGNNGNIRYWVRAEVS 135

  Fly   132 RPWTF---DER--HTIPFTVVKNMPL 152
            |.|.|   ||.  ...||..:..||:
 Worm   136 RSWKFNIVDESSFEIAPFLDLNTMPI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 40/154 (26%)
Arrestin_C 178..305 CDD:280848
arrd-12NP_001309576.1 Arrestin_N 6..157 CDD:389964 39/150 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.