DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-12

DIOPT Version :10

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001309576.1 Gene:arrd-12 / 187636 WormBaseID:WBGene00011053 Length:186 Species:Caenorhabditis elegans


Alignment Length:156 Identity:41/156 - (26%)
Similarity:68/156 - (43%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKW--MEILRKNSNNNE---YSR 67
            :..|..:.||.||..|.|.:..:...:...|.|.||:.|:....:  .|...|.::..|   .:.
 Worm     6 VLFDKPNAVYAAGQKISGRVVFSTASQQNPRWIDVQLHGRSHTFFTRQESETKTNSKGESETKTH 70

  Fly    68 SLFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALG-RQLPSSFKGSYGAIKYKMRVLIQ 131
            ::.||:...:..:..||.....:...|..|::.:.|...|. ..||.||:|:.|.|:|.:|..:.
 Worm    71 TVHYTATAKHLDTAVPLWRKTDKAARLLPGKYEWQFWFQLPCSVLPPSFEGNNGNIRYWVRAEVS 135

  Fly   132 RPWTF---DER--HTIPFTVVKNMPL 152
            |.|.|   ||.  ...||..:..||:
 Worm   136 RSWKFNIVDESSFEIAPFLDLNTMPI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:451447 40/154 (26%)
Arrestin_C 191..308 CDD:214976
arrd-12NP_001309576.1 Arrestin_N 6..157 CDD:451447 39/150 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.