DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-3

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_496010.2 Gene:arrd-3 / 187498 WormBaseID:WBGene00006429 Length:287 Species:Caenorhabditis elegans


Alignment Length:312 Identity:62/312 - (19%)
Similarity:114/312 - (36%) Gaps:56/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ERLRITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEI-------LRKNSN 61
            |..||.||.....|...:.:.|.:.:...|..|.|.::|.:.|..|..|.||       :|.|..
 Worm     2 ECFRIVLDRDTCKYRPEECVTGNVVIINRKELKARTLRVYIKGYQKTSWKEIQQKPSLVVRSNGV 66

  Fly    62 NNEYSRSLFYTSKEV-YEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYK 125
            |.:.:..|....:.: |.|....|.:|......:..|.|.|.|...|....|             
 Worm    67 NVKSTIKLKSHGENIQYIHLYMTLWNFTSDTDCIKPGTHKFPFSFKLPADCP------------- 118

  Fly   126 MRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEK---QVTKTISL-FGTRPITLLALLP 186
                                     |:.|....||..|::   .|:|.|.: |.:..:::....|
 Worm   119 -------------------------PIVPNATYIPKDLQQINGAVSKNIGVFFKSGIVSVKTSFP 158

  Fly   187 EDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKT 251
            :...:.||.:.:...:.|.||..|.::...:.:...:|:....::.:...|.:  :::.:|:..|
 Worm   159 QRVLITGEVIPLTLLIDNKSTCTVREVGVRIFRIARFYAKDQEKMTRQRKIMI--RKSINVEPNT 221

  Fly   252 ERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKV 303
            |:....|..:.:..|..:   |.:|.:.|.:.|:......|:. .||..|.|
 Worm   222 EQQELIEFKVHETVQTFE---SDLIEVKYLMHVDVFTTSAFRG-TLNSVFSV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 29/153 (19%)
Arrestin_C 178..305 CDD:280848 23/126 (18%)
arrd-3NP_496010.2 Arrestin_N 4..>119 CDD:389964 29/152 (19%)
Arrestin_C 147..275 CDD:214976 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.