DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-6

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001254290.1 Gene:arrd-6 / 185541 WormBaseID:WBGene00009579 Length:469 Species:Caenorhabditis elegans


Alignment Length:471 Identity:109/471 - (23%)
Similarity:179/471 - (38%) Gaps:110/471 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEIL----RKNSNNNEY- 65
            :|:..|    ||:||:.|.|.:.:...:..|||.|:|.:.||.... ::::    |:...:::| 
 Worm    36 IRLNKD----VYYAGETISGSVLLENTENIKIRGIRVLLRGKVHAT-LKVVKSGERRTLKDDQYV 95

  Fly    66 --SRSLFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGR-QLPSSFKGSYGAIKYKMR 127
              .:.|.:...:..|....|:         |:.|.|.|.|...|.: .||.|.:..:..|:|..:
 Worm    96 LDEKQLLWGKDKSDESDSVPI---------LARGVHQFSFNFDLPQSSLPCSLESRHCTIRYYFK 151

  Fly   128 VLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTR--PITLLALLPEDFA 190
            |:|..|:....:....||:: ...:..|:....|.|..|..|....:..:  .:.|..:|.....
 Worm   152 VIIDIPYASSPQGIKYFTII-GPHIDSMEEKYLSPLSAQDRKVNCCWCCQRGALALRIILERTAY 215

  Fly   191 VRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQK--------VECIAVATKE---T 244
            |.||.:|:.|.:.|..:|| :.|...::|      ||.:.|:|        :.|:....|.   .
 Worm   216 VCGENIRVRAQIENRQSTA-QSLVIRLVQ------HVEVFVEKGLLGENKMMSCVVFEHKSPAIA 273

  Fly   245 GSVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRV-------EAVLRGFFKNLILNLPFK 302
            .:.|.|.:.:....:.|| ...||...:..:|.|.|.|||       ...|...|...:..:|::
 Worm   274 ANSQGKYDSTLEQPIRLP-VVPPTLVGVCRLIQIYYALRVCMEDEKGNECLHIDFPLTVATIPYR 337

  Fly   303 VYSQDPSNRQSSLRPPPPPRPND--------GP-PGPELGSGNLFEPA-------------LPVY 345
            :    |:       .||||...|        |. ..||...|.:::..             .|||
 Worm   338 I----PN-------APPPPVDYDFCSNHVEGGKYVSPEFRLGQVYDGEGEEINKEEEIVLYRPVY 391

  Fly   346 PSL-DSSIGSPSHSSQFSECSSINSIT--SDSSAATL---------------SPAVGAGTGGMD- 391
            ..| |..||||..|..|..    .|.|  :|||.|.:               :|.:......|| 
 Worm   392 VKLADRRIGSPHVSKDFRS----GSFTRIADSSLALVTEPNGSRRRSILVASNPCLAMRDESMDE 452

  Fly   392 -MSYTSGSQSSQYGSP 406
             :..|:|..|.  |.|
 Worm   453 KLMMTNGCNSE--GDP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 36/153 (24%)
Arrestin_C 178..305 CDD:280848 33/144 (23%)
arrd-6NP_001254290.1 Arrestin_N 34..174 CDD:278754 36/152 (24%)
Arrestin_C 201..336 CDD:214976 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.