DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and ttm-2

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_494855.1 Gene:ttm-2 / 184995 WormBaseID:WBGene00017840 Length:358 Species:Caenorhabditis elegans


Alignment Length:357 Identity:72/357 - (20%)
Similarity:137/357 - (38%) Gaps:74/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ERLRITLDSADRVYF-AGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNN---- 63
            :::|.|: ..||.:: .|..|:|.:....:...:|..::.::  .|:.::.:.|..|.|.|    
 Worm     3 DKIRFTV-LLDRPFYQPGQTIQGHVVCEPHHPLEIDCVEGRL--HGEIQYFQQLPPNHNRNGSPL 64

  Fly    64 --EYSRSLFYTSKEVYEHSETPLPDFEPRGLELSAGEH----------------------TFIFE 104
              ..:|.|.....:::::....    |..||::...|:                      ||..:
 Worm    65 PPSKTRVLIDEKAQLWKYQTVS----EMLGLDVFYDENQNRHFSSESASASSSSLFTTAATFPIQ 125

  Fly   105 VALGRQLPSSF--KGSYGAIKYKMRVLIQRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQV 167
            :.|....|.||  .||..:|::.:.:.:.........|.....|:..           .|:::||
 Worm   126 IELPHFAPPSFYCPGSPVSIRFTLEIQLYNQGFKIASHEENLVVLNY-----------ESIKRQV 179

  Fly   168 T-------KTISLFGTRPITLLALLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYS 225
            |       ||.:....|.|:|..|||.|.......|..|.|:.|...   :.|::..|..|...|
 Worm   180 TPKPVNFQKTFNFPKERSISLEMLLPTDVFTTTARLENCITICNRWK---QSLKYVHLNIVRRIS 241

  Fly   226 HVPLRVQKVECIAVATKETGSVQKKTE------RSFAHELLLPDGAQPTDEQMSGVITIVYELRV 284
            .:....:.::.:.:.|...| :..||:      .||.....:|  |.|.:..::|:....|.|:|
 Worm   242 ALNQNNEVIDTVKIDTTGVG-LPSKTKIAVGETYSFRPTFNVP--ALPPNIHVNGLFKTEYSLKV 303

  Fly   285 EAVLRGFFKNLIL---NLPFKVYSQDPSNRQS 313
            ..   |...|.:|   .:|..:.:.|.|:|:|
 Worm   304 TI---GRAHNFVLASYEVPITIVTMDQSSRRS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 30/176 (17%)
Arrestin_C 178..305 CDD:280848 31/135 (23%)
ttm-2NP_494855.1 Arrestin_N 7..149 CDD:389964 27/148 (18%)
Arrestin_C <231..326 CDD:383149 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.