DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-28

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_509710.2 Gene:arrd-28 / 184759 WormBaseID:WBGene00009000 Length:650 Species:Caenorhabditis elegans


Alignment Length:328 Identity:66/328 - (20%)
Similarity:111/328 - (33%) Gaps:113/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESERLRIT---------LDSAD-RVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKC--KWM 53
            ::.|:|.:|         |:.|| .|.|.         ||..:..::|::::.:||:.:.  .|.
 Worm   326 VDIEKLSVTNVTQSEKKPLERADVEVTFI---------MNSVEPKELRSLRLILTGEVRVGGLWY 381

  Fly    54 EILRKNSNNNEYSRSLFYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGS 118
            |.||..:..|....:|                        ||.|||.|.|      |||      
 Worm   382 EFLRFKAIANLSHETL------------------------LSPGEHNFRF------QLP------ 410

  Fly   119 YGAIKYKMRVLIQRPWTFDER-----HTIPFTVVKNMPLQPMQRSIPSSLE---KQVTKTISLFG 175
            :...:|...:|   |.|..:.     |....::.||...|..:..:...::   |:..|.     
 Worm   411 FADSQYDTSIL---PPTLGDEIKYMIHASTVSLPKNFFQQQCELLVDRFIDTWAKEAYKP----- 467

  Fly   176 TRPITLLALLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVL-------QYV--TYYSHVPLRV 231
              |.|      |::.         ||.|:.|....::.:..::       :||  |......|||
 Worm   468 --PYT------EEYG---------ATKIHLSQRCFKRGKHVIVALQGSEPRYVKGTLVQKKRLRV 515

  Fly   232 QKVECIAVATKETGSVQKKT--------ERSFAHELLLPDGAQPTDEQMS-GVITIVYELRVEAV 287
            ..|:     ..|:...|:..        .:...|.:.:|....|:.|... .|:.|.|...||..
 Worm   516 PNVK-----LDESYCSQRNVRIFEENIHRKDHIHVMHIPFNIPPSIEICYWNVLQIEYHYEVEIT 575

  Fly   288 LRG 290
            |.|
 Worm   576 LEG 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 35/162 (22%)
Arrestin_C 178..305 CDD:280848 27/131 (21%)
arrd-28NP_509710.2 Arrestin_C 153..278 CDD:214976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.