DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrd-9

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_496661.1 Gene:arrd-9 / 184515 WormBaseID:WBGene00008843 Length:312 Species:Caenorhabditis elegans


Alignment Length:330 Identity:67/330 - (20%)
Similarity:119/330 - (36%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYT 72
            |.|...:::::.||.:.|.|.:...|.:..|||.:.|.||.:..|       .|..:..:..::.
 Worm    10 IVLAEPEKLHYPGDTVSGHIVLKFEKFSTCRAITLTVKGKAETGW-------DNVTKVGQWTYFN 67

  Fly    73 SKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPWTFD 137
            ...|...:|......||       |.|...|:..:...:|.||:|.:|.|::.::|.:.||...|
 Worm    68 ESGVLWKAEMSENRIEP-------GTHRIPFDYTVPENIPQSFEGPFGFIRFYIKVHMDRPHALD 125

  Fly   138 ERHTIPFTVVKNMPLQPMQRSIPSSL----------------EKQVTKTISLFGTRPITLLALLP 186
            :.....|.|.:...:...:...|..:                |.|::..|..|            
 Worm   126 QCVKKEFLVTQKPTVVSKKHLGPEHIIRYCQKLNCNRGEIYFEAQLSNRIIFF------------ 178

  Fly   187 EDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHV-----------------PLRVQKV 234
                  .:|:.:...:.|.|:..::|:.....|.:.|||..                 .|:::..
 Worm   179 ------DDPISLIIKIKNCSSRTIKKISLEAFQRIEYYSTTSACRKTHSVLIGKTGKSELKIRND 237

  Fly   235 ECIAVATKETGSVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRGFF-KNLILN 298
            | ||::|......:..|. |||.||                |.:.|.|.|.....||: ..|:..
 Worm   238 E-IAISTFSMKFKEPATP-SFASEL----------------IQVSYVLLVNLFTDGFWAAPLVFP 284

  Fly   299 LPFKV 303
            :.|:|
 Worm   285 VEFEV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 34/143 (24%)
Arrestin_C 178..305 CDD:280848 28/144 (19%)
arrd-9NP_496661.1 Arrestin_N 10..137 CDD:389964 34/140 (24%)
Arrestin_C 162..277 CDD:214976 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.