DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and Txnip

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001008767.1 Gene:Txnip / 117514 RGDID:620886 Length:394 Species:Rattus norvegicus


Alignment Length:378 Identity:83/378 - (21%)
Similarity:154/378 - (40%) Gaps:57/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYT 72
            :..:..::||.:|:.:.|.:.:.|.:.|:::|:::...|..|..||:..::.....:|.|     
  Rat    12 VVFNDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLR----- 71

  Fly    73 SKEVYEHSETPLPDFEPRG----LELSAG---EHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLI 130
                ||  :|.|.:.:|.|    :.:..|   |:.|.||:..| .|.:||||.||.:.|.::..:
  Rat    72 ----YE--DTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQG-PLGTSFKGKYGCVDYWVKAFL 129

  Fly   131 QRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEP 195
            .||....:.....|.|:..:.:.......|.|.:|:...:........:::.|.:.......|:.
  Rat   130 DRPSQPTQEAKKNFEVMDLVDVN
TPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDD 194

  Fly   196 LRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRV--QKVECIAVATKETGSVQKKTERSFAHE 258
            :.|.|...|..:..|......|.:: ||.::...:|  ||:..:......:|:......:|...:
  Rat   195 ISIHADFENTCSRIVVPKAAIVARH-TYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQ 258

  Fly   259 LLLPD--GAQPTDEQMSGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDP-SNRQSS------ 314
            .:.|.  |.        .::.:.|.|.:...:.| .|.:||:||..:.|:.. |:|.||      
  Rat   259 KIRPSILGC--------NILRVEYSLLIYVSVPG-SKKVILDLPLVIGSRSGLSSRTSSMASRTS 314

  Fly   315 -------LRPPPPPRPNDGPPG-----PELGSGNLFEPALPVYPSLDSSIGSP 355
                   |..|..|   :.||.     ||  ...|..|..|:...:|.|..||
  Rat   315 SEMSWIDLNIPDTP---EAPPCYMDVIPE--DHRLESPTTPLLDDVDDSQDSP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 37/150 (25%)
Arrestin_C 178..305 CDD:280848 24/130 (18%)
TxnipNP_001008767.1 Arrestin_N 10..152 CDD:304627 37/151 (25%)
Arrestin_C 174..298 CDD:280848 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.