DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leash and arrdc4

DIOPT Version :9

Sequence 1:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001107732.1 Gene:arrdc4 / 100135736 XenbaseID:XB-GENE-492296 Length:403 Species:Xenopus tropicalis


Alignment Length:405 Identity:88/405 - (21%)
Similarity:140/405 - (34%) Gaps:126/405 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKG-KCK--------WMEILRKNSNNNEYSRSLFYT 72
            |.||:.:.|.:.:.|.:..::.::.::|.|.. .||        |          ..:.::..|.
 Frog    19 YCAGEPVTGYVLLEVLREIRVLSLLLRVCGGAMTCKQGKQLEDAW----------EAFPQATHYL 73

  Fly    73 SKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQ-LPSSFKGSYGAIKYKMRVLIQRP--- 133
            ::| |.....|..|.|.  |...||.|...|...|... |.:||.|.||.:.|:...:::||   
 Frog    74 NEE-YSLLTEPAGDCEI--LLFPAGNHKIPFRFQLPESPLVTSFSGKYGKVYYQTTAVLKRPSVP 135

  Fly   134 --WTFDERHTI-PFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLLALLPEDFAVRGEP 195
              .|..|...: |..|.......|::||      |:|......|.:.||::.|.:.......||.
 Frog   136 PHTTHRELRVLSPINVN
SPSLYTPVERS------KEVMVGCWFFMSGPISVNAKIGRKGYCNGEA 194

  Fly   196 LRICATVINNSTTAV---------------EKLRFTVLQYVTYY--SHV---------------- 227
            :.|.|.:.|.|:..:               .|.| ||.|.:...  :|:                
 Frog   195 IHIYADIENGSSRLIVPKAAIYQTQSFLLDGKTR-TVRQMLASVRGNHIASGSADSWNGKALKIP 258

  Fly   228 PLRVQKVEC--------IAVATKETGSVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRV 284
            |:....:||        :||:....|:.:.|.      ||.|..|..|.:|         :..|.
 Frog   259 PVTPSILECNIIRVEYSLAVSINIPGAKKLKV------ELPLVIGTIPLNE---------FNCRN 308

  Fly   285 EAVLRGFFKN---LILNLPFK----------VYSQDPSNRQSSLR-----------PP------- 318
            .:|...|..:   |.|.||.:          |..:|.|...||:.           ||       
 Frog   309 ASVASQFSMDMSWLALALPEQPEAPPNYADIVSEEDLSRDISSMEDIGDVLEGLHCPPFAVIQEF 373

  Fly   319 ---PPPRPNDGPPGP 330
               |||..::..|.|
 Frog   374 RFQPPPLYSEVDPHP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 35/150 (23%)
Arrestin_C 178..305 CDD:280848 36/180 (20%)
arrdc4NP_001107732.1 Arrestin_N 7..152 CDD:304627 34/145 (23%)
Arrestin_C 175..301 CDD:214976 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.